BLASTX nr result
ID: Scutellaria23_contig00029074
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00029074 (258 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004136939.1| PREDICTED: zinc finger protein-like 1-like [... 90 2e-16 ref|NP_001242749.1| uncharacterized protein LOC100775639 [Glycin... 90 2e-16 ref|NP_001240177.1| uncharacterized protein LOC100805734 [Glycin... 90 2e-16 ref|XP_002264651.1| PREDICTED: zinc finger protein-like 1 [Vitis... 90 2e-16 ref|XP_002300269.1| predicted protein [Populus trichocarpa] gi|2... 90 2e-16 >ref|XP_004136939.1| PREDICTED: zinc finger protein-like 1-like [Cucumis sativus] gi|449478770|ref|XP_004155414.1| PREDICTED: zinc finger protein-like 1-like [Cucumis sativus] Length = 359 Score = 90.1 bits (222), Expect = 2e-16 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 144 MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRT 257 MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRT Sbjct: 1 MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRT 38 >ref|NP_001242749.1| uncharacterized protein LOC100775639 [Glycine max] gi|255642399|gb|ACU21463.1| unknown [Glycine max] Length = 338 Score = 90.1 bits (222), Expect = 2e-16 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 144 MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRT 257 MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRT Sbjct: 1 MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRT 38 >ref|NP_001240177.1| uncharacterized protein LOC100805734 [Glycine max] gi|255634620|gb|ACU17672.1| unknown [Glycine max] Length = 337 Score = 90.1 bits (222), Expect = 2e-16 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 144 MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRT 257 MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRT Sbjct: 1 MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRT 38 >ref|XP_002264651.1| PREDICTED: zinc finger protein-like 1 [Vitis vinifera] gi|296083059|emb|CBI22463.3| unnamed protein product [Vitis vinifera] Length = 359 Score = 90.1 bits (222), Expect = 2e-16 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 144 MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRT 257 MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRT Sbjct: 1 MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRT 38 >ref|XP_002300269.1| predicted protein [Populus trichocarpa] gi|222847527|gb|EEE85074.1| predicted protein [Populus trichocarpa] Length = 325 Score = 90.1 bits (222), Expect = 2e-16 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 144 MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRT 257 MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRT Sbjct: 1 MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRT 38