BLASTX nr result
ID: Scutellaria23_contig00028925
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00028925 (459 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267914.1| PREDICTED: tubby-like F-box protein 8-like [... 77 1e-12 emb|CAN82256.1| hypothetical protein VITISV_009404 [Vitis vinifera] 77 1e-12 ref|XP_003547576.1| PREDICTED: tubby-like F-box protein 8-like [... 75 5e-12 ref|XP_003531569.1| PREDICTED: tubby-like F-box protein 8-like [... 75 5e-12 gb|ADL36842.1| TLP domain class transcription factor [Malus x do... 75 7e-12 >ref|XP_002267914.1| PREDICTED: tubby-like F-box protein 8-like [Vitis vinifera] Length = 425 Score = 77.0 bits (188), Expect = 1e-12 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +3 Query: 333 MSFRSIARDIRDSFGSLSRRSFDVRLSGHHRGKSHGSFHDL 455 MSFRSI RD+RD FGSLSRRSFDVRL GHHRGKSHGS H+L Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFDVRLPGHHRGKSHGSVHEL 41 >emb|CAN82256.1| hypothetical protein VITISV_009404 [Vitis vinifera] Length = 380 Score = 77.0 bits (188), Expect = 1e-12 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +3 Query: 333 MSFRSIARDIRDSFGSLSRRSFDVRLSGHHRGKSHGSFHDL 455 MSFRSI RD+RD FGSLSRRSFDVRL GHHRGKSHGS H+L Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFDVRLPGHHRGKSHGSVHEL 41 >ref|XP_003547576.1| PREDICTED: tubby-like F-box protein 8-like [Glycine max] Length = 410 Score = 75.1 bits (183), Expect = 5e-12 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +3 Query: 333 MSFRSIARDIRDSFGSLSRRSFDVRLSGHHRGKSHGSFHDLN 458 MSFRSI RD+RDSFGSLSRRSFDVRL+GHHRGKS GS DL+ Sbjct: 1 MSFRSIVRDVRDSFGSLSRRSFDVRLTGHHRGKSQGSVQDLH 42 >ref|XP_003531569.1| PREDICTED: tubby-like F-box protein 8-like [Glycine max] Length = 427 Score = 75.1 bits (183), Expect = 5e-12 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +3 Query: 333 MSFRSIARDIRDSFGSLSRRSFDVRLSGHHRGKSHGSFHDLN 458 MSFRSI RD+RDSFGSLSRRSFDVRL+GHHRGKS GS DL+ Sbjct: 1 MSFRSIVRDVRDSFGSLSRRSFDVRLTGHHRGKSQGSVQDLH 42 >gb|ADL36842.1| TLP domain class transcription factor [Malus x domestica] Length = 426 Score = 74.7 bits (182), Expect = 7e-12 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +3 Query: 333 MSFRSIARDIRDSFGSLSRRSFDVRLSGHHRGKSHGSFHDLN 458 MSFRSI RD+RD FGSLSRRSF+VRL GHHRGKSHGS H+++ Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHRGKSHGSVHEVH 42