BLASTX nr result
ID: Scutellaria23_contig00028837
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00028837 (396 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532127.1| leucine-rich repeat containing protein, puta... 55 6e-06 >ref|XP_002532127.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223528186|gb|EEF30247.1| leucine-rich repeat containing protein, putative [Ricinus communis] Length = 1142 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/49 (59%), Positives = 39/49 (79%), Gaps = 3/49 (6%) Frame = +1 Query: 259 MTEAFLRIVLQNLNFLIKDEIGLIMSVDKEMKKPFSI---FQAVLEDAE 396 M EAFL+IVL+NL+ LI++E+GL++ +DKEM+ SI QAVLEDAE Sbjct: 1 MAEAFLQIVLENLDSLIQNEVGLLLGIDKEMESLSSILSTIQAVLEDAE 49