BLASTX nr result
ID: Scutellaria23_contig00028765
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00028765 (320 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001109551.1| hypothetical protein Poptr_cp073 [Populus tr... 108 5e-22 ref|NP_054550.1| hypothetical protein NitaCp076 [Nicotiana tabac... 103 2e-20 ref|NP_054551.1| hypothetical protein NitaCp077 [Nicotiana tabac... 100 2e-19 gb|AAO18644.1| hypothetical protein [Lactuca sativa] gi|66865841... 99 5e-19 ref|NP_054980.1| hypothetical protein SpolCp076 [Spinacia olerac... 66 3e-09 >ref|YP_001109551.1| hypothetical protein Poptr_cp073 [Populus trichocarpa] gi|134093267|ref|YP_001109568.1| hypothetical protein Poptr_cp090 [Populus trichocarpa] gi|133712112|gb|ABO36755.1| conserved hypothetical protein [Populus trichocarpa] gi|133712129|gb|ABO36772.1| conserved hypothetical protein [Populus trichocarpa] Length = 86 Score = 108 bits (270), Expect = 5e-22 Identities = 54/62 (87%), Positives = 55/62 (88%) Frame = +1 Query: 1 FINEVVNGGVTIILFVTRDLVCVLKKRKKKNLSIFRGLKGAWKHIRTLEWKWKGDVTPVP 180 FINEVVNGGVTIILFV +LVCV KKR NLSIFRGLKGAWKHIRTLEWKWK DVTPVP Sbjct: 3 FINEVVNGGVTIILFVVMNLVCVPKKR---NLSIFRGLKGAWKHIRTLEWKWKRDVTPVP 59 Query: 181 SE 186 SE Sbjct: 60 SE 61 >ref|NP_054550.1| hypothetical protein NitaCp076 [Nicotiana tabacum] gi|11466024|ref|NP_054566.1| hypothetical protein NitaCp092 [Nicotiana tabacum] gi|78102590|ref|YP_358729.1| hypothetical protein NisyCp085 [Nicotiana sylvestris] gi|78102609|ref|YP_358748.1| hypothetical protein NisyCp106 [Nicotiana sylvestris] gi|81301620|ref|YP_398915.1| hypothetical protein NitoCp084 [Nicotiana tomentosiformis] gi|81301639|ref|YP_398934.1| hypothetical protein NitoCp105 [Nicotiana tomentosiformis] gi|351653932|ref|YP_004891658.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|351653950|ref|YP_004891677.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|11879|emb|CAA77392.1| hypothetical protein [Nicotiana tabacum] gi|1223680|emb|CAA77401.1| hypothetical protein [Nicotiana tabacum] gi|77799617|dbj|BAE46706.1| hypothetical protein [Nicotiana sylvestris] gi|77799636|dbj|BAE46725.1| hypothetical protein [Nicotiana sylvestris] gi|80750979|dbj|BAE48055.1| hypothetical protein [Nicotiana tomentosiformis] gi|80750998|dbj|BAE48074.1| hypothetical protein [Nicotiana tomentosiformis] gi|347453958|gb|AEO95616.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347453976|gb|AEO95634.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|225249|prf||1211235CH ORF 131 Length = 131 Score = 103 bits (256), Expect = 2e-20 Identities = 59/79 (74%), Positives = 61/79 (77%), Gaps = 3/79 (3%) Frame = -1 Query: 230 KIGFNCQLPL---GLTSDSEGTGVTSPFHFHSRVLMCFHAPLRPRKMDKXXXXXXLRTHT 60 KIGFNCQLPL GLT+DSEGTGVTS FH SRVLM FHAPLRPRKMDK THT Sbjct: 6 KIGFNCQLPLSEIGLTTDSEGTGVTSLFH--SRVLMRFHAPLRPRKMDKFLFLG---THT 60 Query: 59 RSLVTKRIMVTPPLTTSFM 3 R + TKRIMVT PLTTSFM Sbjct: 61 RFVTTKRIMVTLPLTTSFM 79 >ref|NP_054551.1| hypothetical protein NitaCp077 [Nicotiana tabacum] gi|11466025|ref|NP_054567.1| hypothetical protein NitaCp093 [Nicotiana tabacum] gi|78102591|ref|YP_358730.1| hypothetical protein NisyCp086 [Nicotiana sylvestris] gi|78102610|ref|YP_358749.1| hypothetical protein NisyCp107 [Nicotiana sylvestris] gi|81301621|ref|YP_398916.1| hypothetical protein NitoCp085 [Nicotiana tomentosiformis] gi|81301640|ref|YP_398935.1| hypothetical protein NitoCp106 [Nicotiana tomentosiformis] gi|351653933|ref|YP_004891659.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|351653951|ref|YP_004891678.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|11878|emb|CAA77391.1| hypothetical protein [Nicotiana tabacum] gi|1223681|emb|CAA77402.1| hypothetical protein [Nicotiana tabacum] gi|77799618|dbj|BAE46707.1| hypothetical protein [Nicotiana sylvestris] gi|77799637|dbj|BAE46726.1| hypothetical protein [Nicotiana sylvestris] gi|80750980|dbj|BAE48056.1| hypothetical protein [Nicotiana tomentosiformis] gi|80750999|dbj|BAE48075.1| hypothetical protein [Nicotiana tomentosiformis] gi|347453959|gb|AEO95617.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347453977|gb|AEO95635.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454069|gb|AEO95726.1| hypothetical protein [synthetic construct] gi|347454086|gb|AEO95743.1| hypothetical protein [synthetic construct] gi|225250|prf||1211235CJ ORF 70B Length = 70 Score = 100 bits (248), Expect = 2e-19 Identities = 57/73 (78%), Positives = 59/73 (80%), Gaps = 3/73 (4%) Frame = +1 Query: 1 FINEVVNGGVTIILFVTRDLVCVLKKRKKKNLSIFRGLKGAWKHIRTLEWKWKGDVTPVP 180 FINEVVNG VTIILFV +LVCV KKR NLSIFRGLKGAWK IRTLE WK DVTPVP Sbjct: 3 FINEVVNGRVTIILFVVTNLVCVPKKR---NLSIFRGLKGAWKRIRTLE--WKRDVTPVP 57 Query: 181 SESLVNP---RGS 210 SES+VNP RGS Sbjct: 58 SESVVNPISDRGS 70 >gb|AAO18644.1| hypothetical protein [Lactuca sativa] gi|66865841|gb|AAY57522.1| unknown [Lactuca sativa] Length = 99 Score = 98.6 bits (244), Expect = 5e-19 Identities = 53/72 (73%), Positives = 55/72 (76%), Gaps = 3/72 (4%) Frame = +1 Query: 1 FINEVVNGGVTIILFVTRDLVCVLKKRKKKNLSIFRGLKGAWKHIRTLEWKWKGDVTPVP 180 FINEVVNGGVTIILFV + VCV KKR NL IFR LKGAWKHIRTLEWKWK D TPVP Sbjct: 3 FINEVVNGGVTIILFVVTNPVCVPKKR---NLYIFRDLKGAWKHIRTLEWKWKRDGTPVP 59 Query: 181 SE---SLVNPRG 207 SE SL +G Sbjct: 60 SEMVRSLAQKKG 71 >ref|NP_054980.1| hypothetical protein SpolCp076 [Spinacia oleracea] gi|11497592|ref|NP_054999.1| hypothetical protein SpolCp097 [Spinacia oleracea] gi|7636154|emb|CAB88776.1| hypothetical protein [Spinacia oleracea] gi|7636173|emb|CAB88795.1| hypothetical protein [Spinacia oleracea] Length = 47 Score = 65.9 bits (159), Expect = 3e-09 Identities = 36/48 (75%), Positives = 37/48 (77%) Frame = +1 Query: 1 FINEVVNGGVTIILFVTRDLVCVLKKRKKKNLSIFRGLKGAWKHIRTL 144 FINEVVNGGVTIILF + VC KKR NLSIFRG KGA KHIRTL Sbjct: 3 FINEVVNGGVTIILFGVTNAVCAPKKR---NLSIFRGFKGARKHIRTL 47