BLASTX nr result
ID: Scutellaria23_contig00028649
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00028649 (283 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264956.1| PREDICTED: pentatricopeptide repeat-containi... 92 4e-17 sp|O49558.2|PP331_ARATH RecName: Full=Pentatricopeptide repeat-c... 80 1e-13 ref|XP_002305605.1| predicted protein [Populus trichocarpa] gi|2... 72 4e-11 ref|XP_002518527.1| pentatricopeptide repeat-containing protein,... 69 3e-10 >ref|XP_002264956.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21170-like [Vitis vinifera] Length = 569 Score = 92.0 bits (227), Expect = 4e-17 Identities = 41/93 (44%), Positives = 61/93 (65%) Frame = -2 Query: 282 VSEGCCNEFVIALCKEDPSQEISNLLLDVIRRGFVSRVEDLSKYVSKLCADDEWSEAEEL 103 V +GC + FV LC+EDPSQE+S L+ ++I +GF LSK+++ LC + W+EA++L Sbjct: 382 VKDGCYHAFVNVLCEEDPSQEVSKLMGEIIGKGFSPCGSKLSKFITSLCKNGRWTEADDL 441 Query: 102 LDSIQNQGWLLDSLCCGSFMRHYCFGGQIDKAI 4 L+ +G L DS CC + + HYC QID +I Sbjct: 442 LNVTIEKGLLPDSFCCSALVEHYCRSRQIDSSI 474 >sp|O49558.2|PP331_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g21170 Length = 585 Score = 80.5 bits (197), Expect = 1e-13 Identities = 39/94 (41%), Positives = 55/94 (58%), Gaps = 1/94 (1%) Frame = -2 Query: 282 VSEGCCNEFVIALCKED-PSQEISNLLLDVIRRGFVSRVEDLSKYVSKLCADDEWSEAEE 106 + E C EF ALC++D S+E LL+DVI+RGFV LS+ ++ +C W AE+ Sbjct: 395 LDESCYIEFANALCRDDNSSEEEEELLVDVIKRGFVPCTHKLSEVLASMCRKRRWKSAEK 454 Query: 105 LLDSIQNQGWLLDSLCCGSFMRHYCFGGQIDKAI 4 LLDS+ DS CG M YC G+++KA+ Sbjct: 455 LLDSVMEMEVYFDSFACGLLMERYCRSGKLEKAL 488 >ref|XP_002305605.1| predicted protein [Populus trichocarpa] gi|222848569|gb|EEE86116.1| predicted protein [Populus trichocarpa] Length = 564 Score = 72.4 bits (176), Expect = 4e-11 Identities = 38/93 (40%), Positives = 53/93 (56%) Frame = -2 Query: 282 VSEGCCNEFVIALCKEDPSQEISNLLLDVIRRGFVSRVEDLSKYVSKLCADDEWSEAEEL 103 V + + F+ L +ED +E +L D++RRGF LSK++ L W E E+L Sbjct: 376 VKDSTYHAFLDLLSEEDQYEEGYEILGDMMRRGFRPGTVGLSKFILLLSRKRRWREVEDL 435 Query: 102 LDSIQNQGWLLDSLCCGSFMRHYCFGGQIDKAI 4 LD + +G L DSLCC S + HYC QIDKA+ Sbjct: 436 LDLVLEKGLLPDSLCCCSLVEHYCSRRQIDKAV 468 >ref|XP_002518527.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542372|gb|EEF43914.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 599 Score = 69.3 bits (168), Expect = 3e-10 Identities = 35/93 (37%), Positives = 52/93 (55%) Frame = -2 Query: 282 VSEGCCNEFVIALCKEDPSQEISNLLLDVIRRGFVSRVEDLSKYVSKLCADDEWSEAEEL 103 + + + FV L ++D E ++ D++RRGF LSKY++ LC W EAEEL Sbjct: 405 IKDNASDAFVDLLSEKDQYAEGYEIVRDIMRRGFSPCTSSLSKYITLLCKKRRWKEAEEL 464 Query: 102 LDSIQNQGWLLDSLCCGSFMRHYCFGGQIDKAI 4 L + +G L D+L S ++HYC Q DKA+ Sbjct: 465 LYMVLEKGLLPDTLSFCSLVKHYCSSKQTDKAL 497