BLASTX nr result
ID: Scutellaria23_contig00028576
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00028576 (457 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529461.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 >ref|XP_002529461.1| conserved hypothetical protein [Ricinus communis] gi|223531077|gb|EEF32927.1| conserved hypothetical protein [Ricinus communis] Length = 193 Score = 61.6 bits (148), Expect = 6e-08 Identities = 50/141 (35%), Positives = 65/141 (46%), Gaps = 21/141 (14%) Frame = -2 Query: 360 RFKYLYFIVNILIMAVGAEAGLFSSSFFIQSDHHHNKQSV----------ISSPGCAAEK 211 R KYLYFI+N+LI+A+GAEAGL S++F H K V SSP A Sbjct: 30 RPKYLYFIINLLIVALGAEAGLLSAAFSKPILDHDRKHPVPVSTAQDHHQSSSPEQAKVS 89 Query: 210 EDSCLDHKHVEKM--SGGGVEVVKTEKSGSETSIFFIG---------XXXXXXXXXXXXX 64 + ++ EK+ S +V K +K S S+FFIG Sbjct: 90 KTRVVEKSASEKIVRSSSITKVEKVKKCPSMPSLFFIGSGETEVVDQDVVQEHEEEAEEE 149 Query: 63 XXXDLSDQELYHKAEIFIGNF 1 +S QEL+ KAE FIGNF Sbjct: 150 EVEGISGQELFTKAETFIGNF 170