BLASTX nr result
ID: Scutellaria23_contig00028429
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00028429 (344 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274807.1| PREDICTED: major facilitator superfamily dom... 89 4e-16 ref|XP_002515682.1| conserved hypothetical protein [Ricinus comm... 86 4e-15 emb|CAH58645.1| putative transport protein [Plantago major] 85 5e-15 ref|NP_190500.2| major facilitator protein [Arabidopsis thaliana... 83 3e-14 ref|XP_003523346.1| PREDICTED: major facilitator superfamily dom... 83 3e-14 >ref|XP_002274807.1| PREDICTED: major facilitator superfamily domain-containing protein 5 [Vitis vinifera] gi|302143948|emb|CBI23053.3| unnamed protein product [Vitis vinifera] Length = 460 Score = 89.0 bits (219), Expect = 4e-16 Identities = 43/54 (79%), Positives = 45/54 (83%) Frame = +3 Query: 3 VNAFPITVMFGMCSIFLVVASILQRRLAAIGEKPKLEDWAMMKDKNAEDEPLNV 164 VNAFPITVMFGMCSIFL VASILQRRL I +K K EDWA MKDKN E EPLN+ Sbjct: 407 VNAFPITVMFGMCSIFLFVASILQRRLMVIADKSKTEDWASMKDKNMEAEPLNI 460 >ref|XP_002515682.1| conserved hypothetical protein [Ricinus communis] gi|223545225|gb|EEF46734.1| conserved hypothetical protein [Ricinus communis] Length = 460 Score = 85.5 bits (210), Expect = 4e-15 Identities = 39/54 (72%), Positives = 45/54 (83%) Frame = +3 Query: 3 VNAFPITVMFGMCSIFLVVASILQRRLAAIGEKPKLEDWAMMKDKNAEDEPLNV 164 VNAFPITVMFGMCSIFL +ASILQRRL I +KPK EDW +KD++ E EPLN+ Sbjct: 407 VNAFPITVMFGMCSIFLFMASILQRRLMVISDKPKAEDWTALKDRDTEAEPLNI 460 >emb|CAH58645.1| putative transport protein [Plantago major] Length = 179 Score = 85.1 bits (209), Expect = 5e-15 Identities = 38/55 (69%), Positives = 47/55 (85%) Frame = +3 Query: 3 VNAFPITVMFGMCSIFLVVASILQRRLAAIGEKPKLEDWAMMKDKNAEDEPLNVA 167 VNAFPIT+MFGMCSIFL VAS+LQRRL+AIG+KPK E+W ++ KN EDE ++A Sbjct: 125 VNAFPITIMFGMCSIFLFVASLLQRRLSAIGDKPKTEEWTSLRQKNPEDESQDIA 179 >ref|NP_190500.2| major facilitator protein [Arabidopsis thaliana] gi|12324434|gb|AAG52174.1|AC012329_1 putative transporter; 8780-5873 [Arabidopsis thaliana] gi|40823305|gb|AAR92274.1| At3g49310 [Arabidopsis thaliana] gi|46518411|gb|AAS99687.1| At3g49310 [Arabidopsis thaliana] gi|332645006|gb|AEE78527.1| major facilitator protein [Arabidopsis thaliana] Length = 460 Score = 82.8 bits (203), Expect = 3e-14 Identities = 38/54 (70%), Positives = 46/54 (85%) Frame = +3 Query: 3 VNAFPITVMFGMCSIFLVVASILQRRLAAIGEKPKLEDWAMMKDKNAEDEPLNV 164 V+AFPIT+MFGMCSIFL VASILQRRL I EKPK EDW+ MK++N+E +PL + Sbjct: 407 VDAFPITIMFGMCSIFLFVASILQRRLMVISEKPKAEDWSPMKERNSEVDPLTL 460 >ref|XP_003523346.1| PREDICTED: major facilitator superfamily domain-containing protein 5-like [Glycine max] Length = 459 Score = 82.8 bits (203), Expect = 3e-14 Identities = 40/54 (74%), Positives = 46/54 (85%) Frame = +3 Query: 3 VNAFPITVMFGMCSIFLVVASILQRRLAAIGEKPKLEDWAMMKDKNAEDEPLNV 164 V+AFPITVMFGMCSIFL+VA ILQRRL I +KPK EDW MKD++AE EPLN+ Sbjct: 407 VDAFPITVMFGMCSIFLLVACILQRRLMVISDKPKTEDW-QMKDRDAESEPLNI 459