BLASTX nr result
ID: Scutellaria23_contig00028283
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00028283 (230 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002302117.1| SecY protein [Populus trichocarpa] gi|222843... 44 8e-06 >ref|XP_002302117.1| SecY protein [Populus trichocarpa] gi|222843843|gb|EEE81390.1| SecY protein [Populus trichocarpa] Length = 552 Score = 43.5 bits (101), Expect(2) = 8e-06 Identities = 25/40 (62%), Positives = 29/40 (72%), Gaps = 2/40 (5%) Frame = -1 Query: 155 ILDHHLCR--EGFPIGFASILIIVGLINEL*RSYEV*SCM 42 ILDH+L R EGF IGF S+LIIVG I EL RSY+ + M Sbjct: 501 ILDHYLRRINEGFAIGFTSVLIIVGSIIELRRSYQAYNVM 540 Score = 30.8 bits (68), Expect(2) = 8e-06 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -3 Query: 228 YLTKIQASIRFGAGLLLS 175 YLTKIQAS RF GLLLS Sbjct: 476 YLTKIQASTRFWGGLLLS 493