BLASTX nr result
ID: Scutellaria23_contig00028282
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00028282 (329 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004148608.1| PREDICTED: gamma-interferon-inducible lysoso... 57 2e-06 >ref|XP_004148608.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Cucumis sativus] gi|449519974|ref|XP_004167009.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Cucumis sativus] Length = 238 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/57 (45%), Positives = 37/57 (64%) Frame = +1 Query: 154 LAASLCLIIYVSAKPPPHHNLSKISSPQNRVNVSLYYESLCPYCANFIVTHLVKIFQ 324 +A +LC ++ + PP S +V VS+YYE+LCP+CANF+V HLVK+FQ Sbjct: 11 VATALCALLLFLSLPP---------SASEKVTVSVYYEALCPFCANFVVYHLVKLFQ 58