BLASTX nr result
ID: Scutellaria23_contig00027892
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00027892 (638 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003546208.1| PREDICTED: C2 and GRAM domain-containing pro... 90 4e-16 ref|XP_003534985.1| PREDICTED: C2 and GRAM domain-containing pro... 86 6e-15 ref|XP_003594332.1| Synaptotagmin-1 [Medicago truncatula] gi|355... 86 8e-15 ref|XP_002264782.2| PREDICTED: C2 and GRAM domain-containing pro... 85 1e-14 ref|XP_002889456.1| C2 domain-containing protein [Arabidopsis ly... 84 3e-14 >ref|XP_003546208.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Glycine max] Length = 1018 Score = 89.7 bits (221), Expect = 4e-16 Identities = 40/51 (78%), Positives = 45/51 (88%) Frame = -3 Query: 153 MKLLVRVIEAKNIPALDPNGFSDPYVKLQLGKQRFRSKVVKKCLNPSWCEE 1 MKL+VRVIEAKN+P DPNG SDPYV+LQLGK RFR+KV+KKCLNP W EE Sbjct: 1 MKLVVRVIEAKNLPPTDPNGLSDPYVRLQLGKHRFRTKVIKKCLNPKWDEE 51 >ref|XP_003534985.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Glycine max] Length = 1018 Score = 85.9 bits (211), Expect = 6e-15 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = -3 Query: 153 MKLLVRVIEAKNIPALDPNGFSDPYVKLQLGKQRFRSKVVKKCLNPSWCEE 1 MKL+VRVIEAKN+P D NG SDPYV+LQLGK RFR+KV+KKCLNP W EE Sbjct: 1 MKLVVRVIEAKNLPPTDLNGLSDPYVRLQLGKNRFRTKVIKKCLNPKWDEE 51 >ref|XP_003594332.1| Synaptotagmin-1 [Medicago truncatula] gi|355483380|gb|AES64583.1| Synaptotagmin-1 [Medicago truncatula] Length = 1042 Score = 85.5 bits (210), Expect = 8e-15 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = -3 Query: 153 MKLLVRVIEAKNIPALDPNGFSDPYVKLQLGKQRFRSKVVKKCLNPSWCEE 1 MKL+VRVIEA N+P DPNG SDPYV+LQLGKQRFR+KV+KK LNP W EE Sbjct: 1 MKLVVRVIEAMNLPPTDPNGLSDPYVRLQLGKQRFRTKVIKKSLNPKWDEE 51 >ref|XP_002264782.2| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Vitis vinifera] gi|297736702|emb|CBI25738.3| unnamed protein product [Vitis vinifera] Length = 1030 Score = 84.7 bits (208), Expect = 1e-14 Identities = 39/51 (76%), Positives = 46/51 (90%) Frame = -3 Query: 153 MKLLVRVIEAKNIPALDPNGFSDPYVKLQLGKQRFRSKVVKKCLNPSWCEE 1 MKL+VRVIEA+N+PA+D NG SDPYV+LQLG+ RFR+KVVKK LNPSW EE Sbjct: 1 MKLVVRVIEARNLPAMDLNGLSDPYVRLQLGRNRFRTKVVKKSLNPSWGEE 51 >ref|XP_002889456.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297335298|gb|EFH65715.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 1872 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/52 (73%), Positives = 46/52 (88%) Frame = -3 Query: 156 KMKLLVRVIEAKNIPALDPNGFSDPYVKLQLGKQRFRSKVVKKCLNPSWCEE 1 +MKL VRV+EA+N+PA+D NGFSDPYV+LQLGKQR R+KVVKK LNP W E+ Sbjct: 836 EMKLQVRVVEARNLPAMDLNGFSDPYVRLQLGKQRSRTKVVKKNLNPKWAED 887