BLASTX nr result
ID: Scutellaria23_contig00027842
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00027842 (280 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278762.1| PREDICTED: pentatricopeptide repeat-containi... 99 5e-19 ref|XP_003610734.1| Pentatricopeptide repeat-containing protein ... 96 3e-18 ref|XP_002315764.1| predicted protein [Populus trichocarpa] gi|2... 93 2e-17 gb|EEE55297.1| hypothetical protein OsJ_03249 [Oryza sativa Japo... 92 4e-17 gb|EEC71388.1| hypothetical protein OsI_03510 [Oryza sativa Indi... 92 4e-17 >ref|XP_002278762.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14820 [Vitis vinifera] gi|297737070|emb|CBI26271.3| unnamed protein product [Vitis vinifera] Length = 727 Score = 98.6 bits (244), Expect = 5e-19 Identities = 40/52 (76%), Positives = 48/52 (92%) Frame = -2 Query: 270 SSIRIIKNLRICEDCHNFMKMASKVFDREIVIRDRTRFHHCRDGLCSCNDYW 115 S IRIIKNLR+CEDCH F+K+ASKV++REIV+RDRTRFHH +DG+CSC DYW Sbjct: 676 SCIRIIKNLRVCEDCHTFIKLASKVYEREIVVRDRTRFHHYKDGVCSCKDYW 727 >ref|XP_003610734.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355512069|gb|AES93692.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 726 Score = 95.9 bits (237), Expect = 3e-18 Identities = 39/52 (75%), Positives = 45/52 (86%) Frame = -2 Query: 270 SSIRIIKNLRICEDCHNFMKMASKVFDREIVIRDRTRFHHCRDGLCSCNDYW 115 S IRI+KNLRICEDCH+FMK+ SKV+ EIV+RDRTRFHHC G+CSC DYW Sbjct: 675 SCIRIVKNLRICEDCHSFMKLVSKVYQIEIVVRDRTRFHHCSGGICSCRDYW 726 >ref|XP_002315764.1| predicted protein [Populus trichocarpa] gi|222864804|gb|EEF01935.1| predicted protein [Populus trichocarpa] Length = 452 Score = 93.2 bits (230), Expect = 2e-17 Identities = 37/54 (68%), Positives = 46/54 (85%) Frame = -2 Query: 276 KRSSIRIIKNLRICEDCHNFMKMASKVFDREIVIRDRTRFHHCRDGLCSCNDYW 115 K S IRI+KNLR+CEDCH F+K+ SKV+ EI++RDRTRFHH + G+CSCNDYW Sbjct: 399 KGSCIRIVKNLRVCEDCHTFIKLVSKVYGMEIIVRDRTRFHHYKAGVCSCNDYW 452 >gb|EEE55297.1| hypothetical protein OsJ_03249 [Oryza sativa Japonica Group] Length = 706 Score = 92.0 bits (227), Expect = 4e-17 Identities = 37/50 (74%), Positives = 44/50 (88%) Frame = -2 Query: 264 IRIIKNLRICEDCHNFMKMASKVFDREIVIRDRTRFHHCRDGLCSCNDYW 115 IRI+KNLR+CEDCH++ KM SKVF+REIV+RDR RFHH +DG CSC DYW Sbjct: 657 IRIVKNLRVCEDCHDYTKMISKVFNREIVMRDRNRFHHFKDGACSCKDYW 706 >gb|EEC71388.1| hypothetical protein OsI_03510 [Oryza sativa Indica Group] Length = 706 Score = 92.0 bits (227), Expect = 4e-17 Identities = 37/50 (74%), Positives = 44/50 (88%) Frame = -2 Query: 264 IRIIKNLRICEDCHNFMKMASKVFDREIVIRDRTRFHHCRDGLCSCNDYW 115 IRI+KNLR+CEDCH++ KM SKVF+REIV+RDR RFHH +DG CSC DYW Sbjct: 657 IRIVKNLRVCEDCHDYTKMISKVFNREIVMRDRNRFHHFKDGACSCKDYW 706