BLASTX nr result
ID: Scutellaria23_contig00027369
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00027369 (266 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_201433.1| GATA transcription factor 5 [Arabidopsis thalia... 60 2e-07 ref|XP_004170070.1| PREDICTED: GATA transcription factor 5-like ... 59 5e-07 ref|XP_004146485.1| PREDICTED: GATA transcription factor 5-like ... 59 5e-07 ref|XP_002865076.1| zinc finger family protein [Arabidopsis lyra... 58 9e-07 gb|ADL36694.1| GATA domain class transcription factor [Malus x d... 57 2e-06 >ref|NP_201433.1| GATA transcription factor 5 [Arabidopsis thaliana] gi|42573812|ref|NP_975002.1| GATA transcription factor 5 [Arabidopsis thaliana] gi|71660777|sp|Q9FH57.1|GATA5_ARATH RecName: Full=GATA transcription factor 5 gi|10177426|dbj|BAB10711.1| GATA-binding transcription factor-like protein [Arabidopsis thaliana] gi|22531223|gb|AAM97115.1| GATA-binding transcription factor-like protein [Arabidopsis thaliana] gi|34098855|gb|AAQ56810.1| At5g66320 [Arabidopsis thaliana] gi|332010815|gb|AED98198.1| GATA transcription factor 5 [Arabidopsis thaliana] gi|332010816|gb|AED98199.1| GATA transcription factor 5 [Arabidopsis thaliana] Length = 339 Score = 59.7 bits (143), Expect = 2e-07 Identities = 37/76 (48%), Positives = 45/76 (59%), Gaps = 9/76 (11%) Frame = -1 Query: 206 FSGEGDFGSLHESGLSVQAEGLESLEWLSHFVEESFSDYSAAE--GLPPK------AAEG 51 FSG DFGSL S LS+ A+ L +LEWLSHFVE+SF++YS G P + Sbjct: 89 FSGCDDFGSLPTSELSLPADDLANLEWLSHFVEDSFTEYSGPNLTGTPTEKPAWLTGDRK 148 Query: 50 KPETA-KEEPCFSTPV 6 P TA EE CF +PV Sbjct: 149 HPVTAVTEETCFKSPV 164 >ref|XP_004170070.1| PREDICTED: GATA transcription factor 5-like [Cucumis sativus] Length = 322 Score = 58.5 bits (140), Expect = 5e-07 Identities = 33/73 (45%), Positives = 41/73 (56%), Gaps = 11/73 (15%) Frame = -1 Query: 191 DFGSLHESGLSVQAEGLESLEWLSHFVEESFSDYSAAEGLPPKAA-----------EGKP 45 DF SL S L+V A+ LE LEWLSHFVE+SFS +SA P K++ E Sbjct: 75 DFPSLPTSELTVPADDLEDLEWLSHFVEDSFSGFSAPFPSPMKSSKEIATSEEQLVEDDG 134 Query: 44 ETAKEEPCFSTPV 6 + EPCF TP+ Sbjct: 135 SVSPPEPCFKTPI 147 >ref|XP_004146485.1| PREDICTED: GATA transcription factor 5-like [Cucumis sativus] Length = 307 Score = 58.5 bits (140), Expect = 5e-07 Identities = 33/73 (45%), Positives = 41/73 (56%), Gaps = 11/73 (15%) Frame = -1 Query: 191 DFGSLHESGLSVQAEGLESLEWLSHFVEESFSDYSAAEGLPPKAA-----------EGKP 45 DF SL S L+V A+ LE LEWLSHFVE+SFS +SA P K++ E Sbjct: 75 DFPSLPTSELTVPADDLEDLEWLSHFVEDSFSGFSAPFPSPMKSSKEIATSEEQLVEDDG 134 Query: 44 ETAKEEPCFSTPV 6 + EPCF TP+ Sbjct: 135 SVSPPEPCFKTPI 147 >ref|XP_002865076.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297310911|gb|EFH41335.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Length = 339 Score = 57.8 bits (138), Expect = 9e-07 Identities = 38/75 (50%), Positives = 45/75 (60%), Gaps = 9/75 (12%) Frame = -1 Query: 203 SGEGDFGSLHESGLSVQAEGLESLEWLSHFVEESFSDYSAAE--GLP---PKAAEG---K 48 SG DFGSL S LSV A+ L +LEWLSHFV++SF++YS G P P G Sbjct: 90 SGCDDFGSLPTSELSVPADDLANLEWLSHFVDDSFTEYSGPNLTGTPTEKPSWLTGDRKH 149 Query: 47 PET-AKEEPCFSTPV 6 P T A EE CF +PV Sbjct: 150 PVTPATEESCFKSPV 164 >gb|ADL36694.1| GATA domain class transcription factor [Malus x domestica] Length = 331 Score = 57.0 bits (136), Expect = 2e-06 Identities = 32/64 (50%), Positives = 41/64 (64%), Gaps = 9/64 (14%) Frame = -1 Query: 170 SGLSVQAEGLESLEWLSHFVEESFSDYSAAEGLPPKAAEGKPETAK---------EEPCF 18 S LSV A+ LE+LEWLSHFVE+SFS+++ A LP KP++ K E+PCF Sbjct: 103 SELSVPADDLENLEWLSHFVEDSFSEFTTA--LPAGFLPEKPKSEKRPDLETPFPEKPCF 160 Query: 17 STPV 6 TPV Sbjct: 161 KTPV 164