BLASTX nr result
ID: Scutellaria23_contig00027177
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00027177 (365 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003518633.1| PREDICTED: putative lipid phosphate phosphat... 62 4e-08 ref|XP_003518632.1| PREDICTED: putative lipid phosphate phosphat... 62 4e-08 ref|XP_002528074.1| phosphatidic acid phosphatase, putative [Ric... 62 6e-08 ref|XP_002282839.2| PREDICTED: putative lipid phosphate phosphat... 61 1e-07 emb|CBI26965.3| unnamed protein product [Vitis vinifera] 61 1e-07 >ref|XP_003518633.1| PREDICTED: putative lipid phosphate phosphatase 3, chloroplastic-like isoform 2 [Glycine max] Length = 343 Score = 62.4 bits (150), Expect = 4e-08 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +2 Query: 275 VYDKWGNVVCHGDKSVIRQGHKSFPSGHTS 364 VYDKWG+V+CHGDK VI++G+KSFPSGHTS Sbjct: 163 VYDKWGDVICHGDKKVIKEGYKSFPSGHTS 192 >ref|XP_003518632.1| PREDICTED: putative lipid phosphate phosphatase 3, chloroplastic-like isoform 1 [Glycine max] Length = 374 Score = 62.4 bits (150), Expect = 4e-08 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +2 Query: 275 VYDKWGNVVCHGDKSVIRQGHKSFPSGHTS 364 VYDKWG+V+CHGDK VI++G+KSFPSGHTS Sbjct: 194 VYDKWGDVICHGDKKVIKEGYKSFPSGHTS 223 >ref|XP_002528074.1| phosphatidic acid phosphatase, putative [Ricinus communis] gi|223532535|gb|EEF34324.1| phosphatidic acid phosphatase, putative [Ricinus communis] Length = 319 Score = 61.6 bits (148), Expect = 6e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +2 Query: 275 VYDKWGNVVCHGDKSVIRQGHKSFPSGHTS 364 VYD+ GNV+CHGDKSVI++GHKSFPSGHTS Sbjct: 139 VYDQLGNVICHGDKSVIKEGHKSFPSGHTS 168 >ref|XP_002282839.2| PREDICTED: putative lipid phosphate phosphatase 3, chloroplastic-like isoform 1 [Vitis vinifera] Length = 343 Score = 60.8 bits (146), Expect = 1e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 275 VYDKWGNVVCHGDKSVIRQGHKSFPSGHTS 364 VYD+WG+V+CHG SVIR+GHKSFPSGHTS Sbjct: 163 VYDQWGDVICHGKDSVIREGHKSFPSGHTS 192 >emb|CBI26965.3| unnamed protein product [Vitis vinifera] Length = 361 Score = 60.8 bits (146), Expect = 1e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 275 VYDKWGNVVCHGDKSVIRQGHKSFPSGHTS 364 VYD+WG+V+CHG SVIR+GHKSFPSGHTS Sbjct: 173 VYDQWGDVICHGKDSVIREGHKSFPSGHTS 202