BLASTX nr result
ID: Scutellaria23_contig00027030
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00027030 (421 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCF23027.1| auxin influx carrier protein [Mangifera indica] ... 72 5e-11 emb|CCF23028.1| auxin influx carrier protein [Mangifera indica] ... 70 2e-10 ref|NP_001234675.1| LAX2 protein [Solanum lycopersicum] gi|33727... 68 7e-10 emb|CBI37897.3| unnamed protein product [Vitis vinifera] 68 9e-10 ref|XP_002277417.1| PREDICTED: auxin transporter-like protein 5-... 68 9e-10 >emb|CCF23027.1| auxin influx carrier protein [Mangifera indica] gi|381280185|gb|AFG18187.1| auxin influx carrier component [Mangifera indica] Length = 493 Score = 72.0 bits (175), Expect = 5e-11 Identities = 33/49 (67%), Positives = 33/49 (67%), Gaps = 3/49 (6%) Frame = -1 Query: 421 NFIHQIDTFGLFTKCYQCTPQL---PPPHLPNATAPLPHPMPNSTHLHH 284 NFIHQIDTFGLFTKCYQC PQ PPPH N TAP P P H HH Sbjct: 443 NFIHQIDTFGLFTKCYQCPPQALPPPPPHTLNTTAPPPLHHPTMNHTHH 491 >emb|CCF23028.1| auxin influx carrier protein [Mangifera indica] gi|381280187|gb|AFG18188.1| auxin influx carrier component [Mangifera indica] Length = 494 Score = 70.1 bits (170), Expect = 2e-10 Identities = 35/50 (70%), Positives = 35/50 (70%), Gaps = 4/50 (8%) Frame = -1 Query: 421 NFIHQIDTFGLFTKCYQCTPQ-LPP---PHLPNATAPLPHPMPNSTHLHH 284 NFIHQIDTFGLFTKCYQC PQ LPP PH NATAP P P H HH Sbjct: 443 NFIHQIDTFGLFTKCYQCPPQTLPPPPSPHTLNATAPPPLHHPAMNHTHH 492 >ref|NP_001234675.1| LAX2 protein [Solanum lycopersicum] gi|337271822|gb|AEI69669.1| LAX2 protein [Solanum lycopersicum] Length = 494 Score = 68.2 bits (165), Expect = 7e-10 Identities = 33/48 (68%), Positives = 34/48 (70%), Gaps = 2/48 (4%) Frame = -1 Query: 421 NFIHQIDTFGLFTKCYQCTPQ--LPPPHLPNATAPLPHPMPNSTHLHH 284 NFIHQIDTFGLFTKCYQC P PPP LP+ AP P P N TH HH Sbjct: 447 NFIHQIDTFGLFTKCYQCPPPPGSPPPFLPHVGAPRPSP-ANITHHHH 493 >emb|CBI37897.3| unnamed protein product [Vitis vinifera] Length = 489 Score = 67.8 bits (164), Expect = 9e-10 Identities = 29/46 (63%), Positives = 31/46 (67%) Frame = -1 Query: 421 NFIHQIDTFGLFTKCYQCTPQLPPPHLPNATAPLPHPMPNSTHLHH 284 NF+HQIDTFGLFTKCYQC P PP H N T+ P P HLHH Sbjct: 443 NFVHQIDTFGLFTKCYQCPPSSPPQHPLNTTSASVSPPPPLHHLHH 488 >ref|XP_002277417.1| PREDICTED: auxin transporter-like protein 5-like [Vitis vinifera] Length = 489 Score = 67.8 bits (164), Expect = 9e-10 Identities = 29/46 (63%), Positives = 31/46 (67%) Frame = -1 Query: 421 NFIHQIDTFGLFTKCYQCTPQLPPPHLPNATAPLPHPMPNSTHLHH 284 NF+HQIDTFGLFTKCYQC P PP H N T+ P P HLHH Sbjct: 443 NFVHQIDTFGLFTKCYQCPPSSPPQHPLNTTSASVSPPPPLHHLHH 488