BLASTX nr result
ID: Scutellaria23_contig00026977
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00026977 (361 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003589867.1| hypothetical protein MTR_1g040620 [Medicago ... 72 6e-11 ref|XP_003615596.1| Zinc finger MYM-type protein [Medicago trunc... 70 2e-10 ref|XP_003590348.1| Zinc finger MYM-type 1 [Medicago truncatula]... 64 1e-08 gb|AAF82236.1|AC069143_12 Contains similarity to a transposable ... 62 6e-08 ref|NP_173360.1| TTF-type zinc finger protein with HAT dimerizat... 62 6e-08 >ref|XP_003589867.1| hypothetical protein MTR_1g040620 [Medicago truncatula] gi|355478915|gb|AES60118.1| hypothetical protein MTR_1g040620 [Medicago truncatula] Length = 665 Score = 71.6 bits (174), Expect = 6e-11 Identities = 35/88 (39%), Positives = 51/88 (57%), Gaps = 1/88 (1%) Frame = +3 Query: 87 MERYFEKIRPNVETS-FSSVNAXXXXXXXXXXXXXXXEVDMENLPSDPGLRPNIMSYPPN 263 MERY+++ + E + + EVD+ENLP++PG R + Y PN Sbjct: 1 MERYYKRTSESQEVNEVETTPTPTHEQPGPSFKNGFLEVDLENLPANPGERKQLSCYHPN 60 Query: 264 LIEQVRRAYLLKGPCQPREHDFPQKVDG 347 +++RRAYL KGPCQP+EH+FPQ+ G Sbjct: 61 DRDEIRRAYLAKGPCQPKEHNFPQRPFG 88 >ref|XP_003615596.1| Zinc finger MYM-type protein [Medicago truncatula] gi|355516931|gb|AES98554.1| Zinc finger MYM-type protein [Medicago truncatula] Length = 892 Score = 69.7 bits (169), Expect = 2e-10 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = +3 Query: 201 DMENLPSDPGLRPNIMSYPPNLIEQVRRAYLLKGPCQPREHDFPQKVDGN 350 ++E LPSDPG RP + +Y PN E +RRAYL KGPCQP +H+FPQ+ GN Sbjct: 137 NLEELPSDPGKRPKMSTYHPNDQEIIRRAYLQKGPCQPNQHNFPQRKIGN 186 >ref|XP_003590348.1| Zinc finger MYM-type 1 [Medicago truncatula] gi|355479396|gb|AES60599.1| Zinc finger MYM-type 1 [Medicago truncatula] Length = 368 Score = 63.9 bits (154), Expect = 1e-08 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = +3 Query: 195 EVDMENLPSDPGLRPNIMSYPPNLIEQVRRAYLLKGPCQPREHDFP 332 E+D+ LPSDPGLRP ++ Y P+ E++RR Y KGPCQPRE +FP Sbjct: 42 ELDLGKLPSDPGLRPRLLDYHPSDREKIRRYYFQKGPCQPREINFP 87 >gb|AAF82236.1|AC069143_12 Contains similarity to a transposable element Tip100 protein for transposase from Ipomoea purpurea gb|4063769 and is a member of the transmembrane 4 family PF|00335 [Arabidopsis thaliana] Length = 811 Score = 61.6 bits (148), Expect = 6e-08 Identities = 25/47 (53%), Positives = 35/47 (74%) Frame = +3 Query: 195 EVDMENLPSDPGLRPNIMSYPPNLIEQVRRAYLLKGPCQPREHDFPQ 335 ++++ LPSDP R +I+SY PN ++VRR YL++GPCQPR H F Q Sbjct: 56 DINLNELPSDPAKRKSILSYHPNQRDEVRREYLIRGPCQPRGHKFKQ 102 >ref|NP_173360.1| TTF-type zinc finger protein with HAT dimerization domain [Arabidopsis thaliana] gi|332191703|gb|AEE29824.1| TTF-type zinc finger protein with HAT dimerization domain [Arabidopsis thaliana] Length = 769 Score = 61.6 bits (148), Expect = 6e-08 Identities = 25/47 (53%), Positives = 35/47 (74%) Frame = +3 Query: 195 EVDMENLPSDPGLRPNIMSYPPNLIEQVRRAYLLKGPCQPREHDFPQ 335 ++++ LPSDP R +I+SY PN ++VRR YL++GPCQPR H F Q Sbjct: 14 DINLNELPSDPAKRKSILSYHPNQRDEVRREYLIRGPCQPRGHKFKQ 60