BLASTX nr result
ID: Scutellaria23_contig00026659
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00026659 (218 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511860.1| gibberellin 20-oxidase, putative [Ricinus co... 91 7e-17 ref|XP_002274751.1| PREDICTED: gibberellin 20 oxidase 1-B [Vitis... 91 1e-16 ref|XP_004173039.1| PREDICTED: gibberellin 3-beta-dioxygenase 4-... 90 2e-16 ref|XP_004138503.1| PREDICTED: gibberellin 3-beta-dioxygenase 4-... 90 2e-16 ref|XP_002510984.1| gibberellin 20-oxidase, putative [Ricinus co... 88 6e-16 >ref|XP_002511860.1| gibberellin 20-oxidase, putative [Ricinus communis] gi|223549040|gb|EEF50529.1| gibberellin 20-oxidase, putative [Ricinus communis] Length = 317 Score = 91.3 bits (225), Expect = 7e-17 Identities = 41/68 (60%), Positives = 54/68 (79%) Frame = +2 Query: 14 SNQIFDLPTEVKLKAGPLSAVKTYTPHFIASPFFESLRVSGPHFSVSAEISSQTLQNETN 193 S IF LP+E+K K GP S++KTYTPHFIASP+FESLRVSGP+F SA+ S+ L N+ N Sbjct: 56 SQNIFSLPSEIKFKLGPSSSIKTYTPHFIASPYFESLRVSGPNFLASAQSSADVLFNQQN 115 Query: 194 REFSEMIE 217 EFS++++ Sbjct: 116 SEFSDVLQ 123 >ref|XP_002274751.1| PREDICTED: gibberellin 20 oxidase 1-B [Vitis vinifera] gi|147834194|emb|CAN75307.1| hypothetical protein VITISV_040404 [Vitis vinifera] gi|297745296|emb|CBI40376.3| unnamed protein product [Vitis vinifera] Length = 328 Score = 90.5 bits (223), Expect = 1e-16 Identities = 42/68 (61%), Positives = 54/68 (79%) Frame = +2 Query: 14 SNQIFDLPTEVKLKAGPLSAVKTYTPHFIASPFFESLRVSGPHFSVSAEISSQTLQNETN 193 S +F LP++ KLK GP S++KTYTPHFIASPFFESLRVSGP F VSA+ S+ L ++ N Sbjct: 57 SKSLFSLPSDTKLKLGPFSSLKTYTPHFIASPFFESLRVSGPDFFVSAQSSADVLFDKQN 116 Query: 194 REFSEMIE 217 EFSE+++ Sbjct: 117 SEFSEVLQ 124 >ref|XP_004173039.1| PREDICTED: gibberellin 3-beta-dioxygenase 4-like [Cucumis sativus] Length = 323 Score = 90.1 bits (222), Expect = 2e-16 Identities = 43/69 (62%), Positives = 59/69 (85%), Gaps = 1/69 (1%) Frame = +2 Query: 14 SNQIFDLPTEVKLKAGPLSAVKTYTPHFIASPFFESLRVSGPHFSVSAEISSQTLQNE-T 190 SN+IF+LP+E KLK GPLS+V TYTPHFIASPFFE+LRVSGP+F SA+ S++ L N+ + Sbjct: 56 SNEIFNLPSETKLKIGPLSSVNTYTPHFIASPFFETLRVSGPNFLASAQNSAEFLFNQKS 115 Query: 191 NREFSEMIE 217 + +FSE+++ Sbjct: 116 SHQFSEILQ 124 >ref|XP_004138503.1| PREDICTED: gibberellin 3-beta-dioxygenase 4-like [Cucumis sativus] Length = 323 Score = 90.1 bits (222), Expect = 2e-16 Identities = 43/69 (62%), Positives = 59/69 (85%), Gaps = 1/69 (1%) Frame = +2 Query: 14 SNQIFDLPTEVKLKAGPLSAVKTYTPHFIASPFFESLRVSGPHFSVSAEISSQTLQNE-T 190 SN+IF+LP+E KLK GPLS+V TYTPHFIASPFFE+LRVSGP+F SA+ S++ L N+ + Sbjct: 56 SNEIFNLPSETKLKIGPLSSVNTYTPHFIASPFFETLRVSGPNFLASAQNSAEFLFNQKS 115 Query: 191 NREFSEMIE 217 + +FSE+++ Sbjct: 116 SHQFSEILQ 124 >ref|XP_002510984.1| gibberellin 20-oxidase, putative [Ricinus communis] gi|223550099|gb|EEF51586.1| gibberellin 20-oxidase, putative [Ricinus communis] Length = 318 Score = 88.2 bits (217), Expect = 6e-16 Identities = 42/65 (64%), Positives = 51/65 (78%) Frame = +2 Query: 14 SNQIFDLPTEVKLKAGPLSAVKTYTPHFIASPFFESLRVSGPHFSVSAEISSQTLQNETN 193 ++ +F+LP E K+K GP S++KTYTPHFIASPFFESLRVSGP F SA+ SSQ L + N Sbjct: 56 ADHLFNLPCESKIKIGPSSSIKTYTPHFIASPFFESLRVSGPDFFASAQTSSQVLFHHPN 115 Query: 194 REFSE 208 EFSE Sbjct: 116 PEFSE 120