BLASTX nr result
ID: Scutellaria23_contig00026375
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00026375 (266 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT38749.2| F-box protein, putative [Solanum demissum] 57 1e-06 gb|AAT38720.1| Putative F-Box protein, identical [Solanum demissum] 55 8e-06 >gb|AAT38749.2| F-box protein, putative [Solanum demissum] Length = 339 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/58 (46%), Positives = 35/58 (60%) Frame = +1 Query: 46 VTVVKKSFVLWNPATKESKILPDFHGRRVNPIQVYITKYGFGYDEISDDYKVFAVMSV 219 + ++ K VLWNPA K+SK LP + N Y+ KYGFGYDE DDYKV + + Sbjct: 15 IEILLKETVLWNPAVKKSKKLPTLGAKLRNGCSYYL-KYGFGYDETRDDYKVVVIQCI 71 >gb|AAT38720.1| Putative F-Box protein, identical [Solanum demissum] Length = 372 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/50 (52%), Positives = 31/50 (62%) Frame = +1 Query: 70 VLWNPATKESKILPDFHGRRVNPIQVYITKYGFGYDEISDDYKVFAVMSV 219 VLWNPA K+SK LP + N Y+ KYGFGYDE DDYKV + + Sbjct: 124 VLWNPAVKKSKKLPTLGAKLRNGCSYYL-KYGFGYDETRDDYKVVVIQCI 172