BLASTX nr result
ID: Scutellaria23_contig00026180
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00026180 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAW22874.1| putative protein kinase [Solanum lycopersicum] 56 3e-06 >gb|AAW22874.1| putative protein kinase [Solanum lycopersicum] Length = 586 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = +2 Query: 176 ALGGSGATIAAVYGSATTVCSIVAQQPIQEIQCW 277 ALGGS T+A VYGS+ T+C I+A QPIQ IQCW Sbjct: 24 ALGGSATTLAVVYGSSATICGIIANQPIQTIQCW 57