BLASTX nr result
ID: Scutellaria23_contig00026157
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00026157 (255 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313276.1| predicted protein [Populus trichocarpa] gi|2... 62 6e-08 ref|XP_002523232.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 ref|XP_002268943.1| PREDICTED: F-box/kelch-repeat protein At5g26... 60 2e-07 ref|XP_002874330.1| kelch repeat-containing F-box family protein... 58 7e-07 ref|XP_004159361.1| PREDICTED: F-box/kelch-repeat protein At5g26... 57 2e-06 >ref|XP_002313276.1| predicted protein [Populus trichocarpa] gi|222849684|gb|EEE87231.1| predicted protein [Populus trichocarpa] Length = 420 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -3 Query: 253 DLLRRSGRPERGLKEGLVLVYDCDGGEWSRAADMPQ 146 DLLRRSGR RGLKEGLVL+YDC GEWSR D+P+ Sbjct: 373 DLLRRSGRSVRGLKEGLVLIYDCISGEWSRGPDLPE 408 >ref|XP_002523232.1| conserved hypothetical protein [Ricinus communis] gi|223537528|gb|EEF39153.1| conserved hypothetical protein [Ricinus communis] Length = 420 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -3 Query: 253 DLLRRSGRPERGLKEGLVLVYDCDGGEWSRAADMPQ 146 DLLRRSGR RGL+EGLVL+YDC GEWSR D+P+ Sbjct: 373 DLLRRSGRNVRGLREGLVLIYDCADGEWSRGPDLPE 408 >ref|XP_002268943.1| PREDICTED: F-box/kelch-repeat protein At5g26960-like [Vitis vinifera] Length = 416 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -3 Query: 253 DLLRRSGRPERGLKEGLVLVYDCDGGEWSRAADMPQ 146 DLLRRSGR RGL+EGLVL+YD GEWSR AD+P+ Sbjct: 369 DLLRRSGRSTRGLREGLVLIYDAAAGEWSRGADLPE 404 >ref|XP_002874330.1| kelch repeat-containing F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297320167|gb|EFH50589.1| kelch repeat-containing F-box family protein [Arabidopsis lyrata subsp. lyrata] Length = 410 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -3 Query: 253 DLLRRSGRPERGLKEGLVLVYDCDGGEWSRAADMPQ 146 DLLRRSGR ERGL+E LVL+YD GEW RAAD+P+ Sbjct: 363 DLLRRSGRSERGLRESLVLLYDTTDGEWRRAADLPE 398 >ref|XP_004159361.1| PREDICTED: F-box/kelch-repeat protein At5g26960-like [Cucumis sativus] Length = 439 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -3 Query: 253 DLLRRSGRPERGLKEGLVLVYDCDGGEWSRAADMPQ 146 DLLRRSGR RGLKEGLVL+Y+ GEW R A+MP+ Sbjct: 392 DLLRRSGRSARGLKEGLVLIYETKSGEWRRGAEMPE 427