BLASTX nr result
ID: Scutellaria23_contig00026126
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00026126 (409 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004154602.1| PREDICTED: ELMO domain-containing protein A-... 62 4e-08 ref|XP_004139936.1| PREDICTED: ELMO domain-containing protein A-... 62 4e-08 ref|XP_002272217.2| PREDICTED: ELMO domain-containing protein A-... 62 4e-08 ref|XP_002319363.1| predicted protein [Populus trichocarpa] gi|2... 61 1e-07 gb|AAF86529.1|AC002560_22 F21B7.23 [Arabidopsis thaliana] 57 1e-06 >ref|XP_004154602.1| PREDICTED: ELMO domain-containing protein A-like [Cucumis sativus] Length = 340 Score = 62.4 bits (150), Expect = 4e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 409 EVLQVTRTQLERELSLEDVHRIQDLPAYNML 317 EVLQVTRTQLERELSLEDVHRIQDLPAYN+L Sbjct: 308 EVLQVTRTQLERELSLEDVHRIQDLPAYNLL 338 >ref|XP_004139936.1| PREDICTED: ELMO domain-containing protein A-like [Cucumis sativus] Length = 233 Score = 62.4 bits (150), Expect = 4e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 409 EVLQVTRTQLERELSLEDVHRIQDLPAYNML 317 EVLQVTRTQLERELSLEDVHRIQDLPAYN+L Sbjct: 201 EVLQVTRTQLERELSLEDVHRIQDLPAYNLL 231 >ref|XP_002272217.2| PREDICTED: ELMO domain-containing protein A-like [Vitis vinifera] gi|297739246|emb|CBI28897.3| unnamed protein product [Vitis vinifera] Length = 235 Score = 62.4 bits (150), Expect = 4e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 409 EVLQVTRTQLERELSLEDVHRIQDLPAYNML 317 EVLQVTRTQLERELSLEDVHRIQDLPAYN+L Sbjct: 203 EVLQVTRTQLERELSLEDVHRIQDLPAYNLL 233 >ref|XP_002319363.1| predicted protein [Populus trichocarpa] gi|222857739|gb|EEE95286.1| predicted protein [Populus trichocarpa] Length = 239 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 409 EVLQVTRTQLERELSLEDVHRIQDLPAYNML 317 EVLQVTRTQLERELSLEDVHRI+DLPAYN+L Sbjct: 207 EVLQVTRTQLERELSLEDVHRIKDLPAYNLL 237 >gb|AAF86529.1|AC002560_22 F21B7.23 [Arabidopsis thaliana] Length = 248 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 409 EVLQVTRTQLERELSLEDVHRIQDLPAYNML 317 EVLQ TR QLERELSL+D+HRIQDLPAYN+L Sbjct: 216 EVLQATRNQLERELSLDDIHRIQDLPAYNLL 246