BLASTX nr result
ID: Scutellaria23_contig00025350
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00025350 (289 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] g... 69 4e-10 >ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] gi|355477354|gb|AES58557.1| Ribosomal protein S3 [Medicago truncatula] Length = 306 Score = 68.9 bits (167), Expect = 4e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = +2 Query: 113 MGQRIKRFDFVSRDPPQVGFESRVMGHYPARFGE 214 MGQRIKRFDFVSRD PQVGFESRVMG YPARFGE Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGE 34