BLASTX nr result
ID: Scutellaria23_contig00025297
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00025297 (278 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001234202.1| NRC1 [Solanum lycopersicum] gi|83630761|gb|A... 67 1e-09 >ref|NP_001234202.1| NRC1 [Solanum lycopersicum] gi|83630761|gb|ABC26878.1| NRC1 [Solanum lycopersicum] Length = 888 Score = 67.0 bits (162), Expect = 1e-09 Identities = 41/88 (46%), Positives = 57/88 (64%), Gaps = 1/88 (1%) Frame = -1 Query: 278 IEGTDLVDWEASAHHFPRLSRLNLRNCEKLKQVPIGLAHIPTLQHLD-*HSTKLAIASAK 102 IE +LV W AS HFPRL L++ +C+KL+++PIGLA I +LQ +D +STK A SA+ Sbjct: 798 IERANLVSWNASGDHFPRLKHLHI-SCDKLEKIPIGLADICSLQVMDLRNSTKSAAKSAR 856 Query: 101 EIQDEKQKILKEQGIVSGVFNLYISSPE 18 EIQ +K K+ Q S F L + P+ Sbjct: 857 EIQAKKNKL---QPAKSQKFELSVFPPD 881