BLASTX nr result
ID: Scutellaria23_contig00025122
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00025122 (447 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD64972.1| cystatin domain containing protein [Brassica oler... 58 7e-07 ref|XP_003597895.1| Cysteine proteinase inhibitor [Medicago trun... 56 3e-06 gb|ADD10748.1| phytocystatin 5 [Brassica rapa subsp. pekinensis] 55 6e-06 >gb|ABD64972.1| cystatin domain containing protein [Brassica oleracea] Length = 120 Score = 58.2 bits (139), Expect = 7e-07 Identities = 32/78 (41%), Positives = 42/78 (53%), Gaps = 4/78 (5%) Frame = +3 Query: 3 IRDPNDRWAVMAAKFAVMSYNYRTNKTLNFVFVVKGKQRVVNGMTYDLVISVEDGVTT-- 176 + D ND V KF+V YN ++ L FV VV G+ +VV GM Y L+++V DGV T Sbjct: 32 LSDVNDPHVVEIGKFSVSEYNKQSKAGLKFVAVVSGESQVVAGMNYRLIVAVNDGVETAG 91 Query: 177 --HPKTYRIVVLWRVWAK 224 K Y +V R W K Sbjct: 92 AGASKNYEAIVWERAWLK 109 >ref|XP_003597895.1| Cysteine proteinase inhibitor [Medicago truncatula] gi|87162937|gb|ABD28732.1| Proteinase inhibitor I25, cystatin [Medicago truncatula] gi|355486943|gb|AES68146.1| Cysteine proteinase inhibitor [Medicago truncatula] Length = 112 Score = 56.2 bits (134), Expect = 3e-06 Identities = 31/83 (37%), Positives = 47/83 (56%) Frame = +3 Query: 3 IRDPNDRWAVMAAKFAVMSYNYRTNKTLNFVFVVKGKQRVVNGMTYDLVISVEDGVTTHP 182 I+D ND ++ A FAV YN T L ++KG+ +V +G+ YDL++S DG +H Sbjct: 31 IKDINDPHVIVIANFAVTEYNKHTGANLKLDKLIKGESQVTSGIYYDLILSAGDG--SHS 88 Query: 183 KTYRIVVLWRVWAKVNKYVLISF 251 Y+ + VW K ++ LISF Sbjct: 89 NIYKAL----VWEKTWQHNLISF 107 >gb|ADD10748.1| phytocystatin 5 [Brassica rapa subsp. pekinensis] Length = 120 Score = 55.1 bits (131), Expect = 6e-06 Identities = 30/78 (38%), Positives = 41/78 (52%), Gaps = 4/78 (5%) Frame = +3 Query: 3 IRDPNDRWAVMAAKFAVMSYNYRTNKTLNFVFVVKGKQRVVNGMTYDLVISVEDGV---- 170 + D ND V +F+V YN ++ L FV VV G+ +VV GM Y L+++V DGV Sbjct: 32 LSDVNDPHVVEIGRFSVSEYNMQSKSGLKFVAVVSGETQVVAGMNYRLIVAVNDGVKIAG 91 Query: 171 TTHPKTYRIVVLWRVWAK 224 K Y +V R W K Sbjct: 92 AGASKNYEAIVWERAWLK 109