BLASTX nr result
ID: Scutellaria23_contig00024807
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00024807 (717 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum]... 94 3e-17 ref|XP_002335728.1| predicted protein [Populus trichocarpa] gi|2... 78 2e-12 >gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum] gi|224352|prf||1102209F ORF 6 Length = 79 Score = 93.6 bits (231), Expect(2) = 3e-17 Identities = 46/60 (76%), Positives = 50/60 (83%), Gaps = 3/60 (5%) Frame = +1 Query: 22 MKVDYLSVHFKTSIIPSRTKHESFDSFGSHAQLLRVNYHRFFYECNEPI---LFIVQKKL 192 MKVDY S+ F+ SIIPSRTKHESFDSFGSHAQLL+VN H FFYECNEPI LFI QK + Sbjct: 1 MKVDYFSIPFQNSIIPSRTKHESFDSFGSHAQLLKVNSHIFFYECNEPIFSSLFIFQKDI 60 Score = 20.8 bits (42), Expect(2) = 3e-17 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 206 PKYLEDSSD 232 PKY EDSSD Sbjct: 66 PKYSEDSSD 74 >ref|XP_002335728.1| predicted protein [Populus trichocarpa] gi|222834616|gb|EEE73079.1| predicted protein [Populus trichocarpa] Length = 79 Score = 77.8 bits (190), Expect = 2e-12 Identities = 40/54 (74%), Positives = 46/54 (85%), Gaps = 3/54 (5%) Frame = +1 Query: 22 MKVDYLSVHFKTSIIPSRTKHESFDSFGSHAQLLRV---NYHRFFYECNEPILF 174 MKVDYLS+H KTS+IPSRTKHESFDSFGSHAQL+++ N H FF + NEPILF Sbjct: 1 MKVDYLSIHCKTSMIPSRTKHESFDSFGSHAQLVQLLMGNSHLFF-DWNEPILF 53