BLASTX nr result
ID: Scutellaria23_contig00024754
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00024754 (352 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307264.1| predicted protein [Populus trichocarpa] gi|2... 72 1e-17 ref|XP_002310141.1| predicted protein [Populus trichocarpa] gi|2... 72 3e-17 ref|XP_003529413.1| PREDICTED: uncharacterized protein LOC100786... 68 1e-15 ref|XP_002523579.1| conserved hypothetical protein [Ricinus comm... 66 4e-15 ref|XP_003555998.1| PREDICTED: uncharacterized protein LOC100779... 68 7e-15 >ref|XP_002307264.1| predicted protein [Populus trichocarpa] gi|222856713|gb|EEE94260.1| predicted protein [Populus trichocarpa] Length = 177 Score = 72.4 bits (176), Expect(2) = 1e-17 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +1 Query: 181 SVTDDDLDELRGCFDLGFSFDSPDLDRRLSSTFPALEFYHAV 306 SVTD+DLDEL+GC +LGF FDSP++D+RLS TFPALE Y+AV Sbjct: 67 SVTDEDLDELKGCIELGFGFDSPEMDQRLSDTFPALELYYAV 108 Score = 42.0 bits (97), Expect(2) = 1e-17 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 Query: 83 PSPLCKQNSWSPDILRDEAW 142 PSPL KQ+SWSPDI RDEAW Sbjct: 34 PSPLYKQHSWSPDIYRDEAW 53 >ref|XP_002310141.1| predicted protein [Populus trichocarpa] gi|222853044|gb|EEE90591.1| predicted protein [Populus trichocarpa] Length = 183 Score = 72.4 bits (176), Expect(2) = 3e-17 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +1 Query: 181 SVTDDDLDELRGCFDLGFSFDSPDLDRRLSSTFPALEFYHAV 306 SVTD+DLDEL+GC +LGF FDSP++D+RLS TFPALE Y+AV Sbjct: 72 SVTDEDLDELKGCIELGFGFDSPEMDQRLSDTFPALELYYAV 113 Score = 40.8 bits (94), Expect(2) = 3e-17 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 Query: 83 PSPLCKQNSWSPDILRDEAW 142 PSPL KQ+SWSPDI RDEAW Sbjct: 39 PSPLYKQHSWSPDIDRDEAW 58 >ref|XP_003529413.1| PREDICTED: uncharacterized protein LOC100786207 [Glycine max] Length = 170 Score = 67.8 bits (164), Expect(2) = 1e-15 Identities = 28/42 (66%), Positives = 37/42 (88%) Frame = +1 Query: 181 SVTDDDLDELRGCFDLGFSFDSPDLDRRLSSTFPALEFYHAV 306 S+++DDLDEL+ CF+LGF FDSP++D +LS+T PALE YHAV Sbjct: 57 SLSEDDLDELKACFELGFGFDSPEIDPKLSNTIPALELYHAV 98 Score = 40.0 bits (92), Expect(2) = 1e-15 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +2 Query: 83 PSPLCKQNSWSPDILRDEAWR 145 P PL KQ SWSPD LRDEAW+ Sbjct: 14 PRPLYKQQSWSPDTLRDEAWQ 34 >ref|XP_002523579.1| conserved hypothetical protein [Ricinus communis] gi|223537141|gb|EEF38774.1| conserved hypothetical protein [Ricinus communis] Length = 300 Score = 66.2 bits (160), Expect(2) = 4e-15 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = +1 Query: 181 SVTDDDLDELRGCFDLGFSFDSPDLDRRLSSTFPALEFYHAV 306 SVTD+D+DEL+ C +LGF FDSP++D+RLS T PAL YHAV Sbjct: 189 SVTDEDVDELKACIELGFGFDSPEMDQRLSDTLPALGLYHAV 230 Score = 39.7 bits (91), Expect(2) = 4e-15 Identities = 21/32 (65%), Positives = 23/32 (71%), Gaps = 4/32 (12%) Frame = +2 Query: 59 PPRLRRG---APS-PLCKQNSWSPDILRDEAW 142 PPR + APS PL KQ+SWSPDI RDEAW Sbjct: 144 PPRAAQHKLLAPSLPLYKQHSWSPDIYRDEAW 175 >ref|XP_003555998.1| PREDICTED: uncharacterized protein LOC100779573 [Glycine max] Length = 164 Score = 67.8 bits (164), Expect(2) = 7e-15 Identities = 28/42 (66%), Positives = 37/42 (88%) Frame = +1 Query: 181 SVTDDDLDELRGCFDLGFSFDSPDLDRRLSSTFPALEFYHAV 306 S+++DDLDEL+ CF+LGF FDSP++D +LS+T PALE YHAV Sbjct: 52 SLSEDDLDELKACFELGFGFDSPEIDPKLSNTIPALELYHAV 93 Score = 37.4 bits (85), Expect(2) = 7e-15 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +2 Query: 83 PSPLCKQNSWSPDILRDEAWR 145 P L KQ SWSPD+LRDEAW+ Sbjct: 13 PRSLHKQQSWSPDMLRDEAWQ 33