BLASTX nr result
ID: Scutellaria23_contig00024483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00024483 (236 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002331487.1| predicted protein [Populus trichocarpa] gi|2... 114 1e-23 ref|XP_004148898.1| PREDICTED: pentatricopeptide repeat-containi... 111 7e-23 ref|XP_003625322.1| Pentatricopeptide repeat protein [Medicago t... 104 7e-21 ref|XP_002443092.1| hypothetical protein SORBIDRAFT_08g008260 [S... 92 4e-17 ref|XP_002309169.1| predicted protein [Populus trichocarpa] gi|2... 91 1e-16 >ref|XP_002331487.1| predicted protein [Populus trichocarpa] gi|222873565|gb|EEF10696.1| predicted protein [Populus trichocarpa] Length = 606 Score = 114 bits (284), Expect = 1e-23 Identities = 51/75 (68%), Positives = 63/75 (84%) Frame = +3 Query: 6 LDPKDSGTYVLLASLCANQRKWGDVRMARSMMRERGIKKTPGSSLIEVEGVFHEFLVGDE 185 LDP+DSG YVLLA++CA+ R+WGDV+MAR MMRER +KK PG S++EVEG FHEFL GDE Sbjct: 520 LDPEDSGIYVLLANICASGRRWGDVKMARRMMRERRVKKIPGRSIVEVEGQFHEFLAGDE 579 Query: 186 SHPKSKAIYKVLAEL 230 SHP+S+ IY L +L Sbjct: 580 SHPQSEGIYNALDQL 594 >ref|XP_004148898.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Cucumis sativus] Length = 675 Score = 111 bits (277), Expect = 7e-23 Identities = 52/77 (67%), Positives = 62/77 (80%) Frame = +3 Query: 6 LDPKDSGTYVLLASLCANQRKWGDVRMARSMMRERGIKKTPGSSLIEVEGVFHEFLVGDE 185 LDP+DSG Y LLA++CA+ +KW DVRM R MMRERG+KK PG SLIE+EG FHEFLV D Sbjct: 585 LDPEDSGIYSLLANICADGKKWKDVRMVRRMMRERGVKKVPGHSLIEIEGKFHEFLVADT 644 Query: 186 SHPKSKAIYKVLAELLL 236 SH +S IY+V+ ELLL Sbjct: 645 SHTRSSEIYRVVNELLL 661 >ref|XP_003625322.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355500337|gb|AES81540.1| Pentatricopeptide repeat protein [Medicago truncatula] Length = 1024 Score = 104 bits (260), Expect = 7e-21 Identities = 47/71 (66%), Positives = 59/71 (83%) Frame = +3 Query: 6 LDPKDSGTYVLLASLCANQRKWGDVRMARSMMRERGIKKTPGSSLIEVEGVFHEFLVGDE 185 LDP+DSG YVLLA+ CAN RKW DVR RS+M+++G+KK PG SLIE++G F EFLV DE Sbjct: 689 LDPEDSGIYVLLANTCANDRKWSDVRRVRSLMKDKGVKKIPGYSLIEIDGGFVEFLVADE 748 Query: 186 SHPKSKAIYKV 218 SHP+S+ IYK+ Sbjct: 749 SHPQSEEIYKL 759 >ref|XP_002443092.1| hypothetical protein SORBIDRAFT_08g008260 [Sorghum bicolor] gi|241943785|gb|EES16930.1| hypothetical protein SORBIDRAFT_08g008260 [Sorghum bicolor] Length = 655 Score = 92.0 bits (227), Expect = 4e-17 Identities = 42/77 (54%), Positives = 55/77 (71%) Frame = +3 Query: 6 LDPKDSGTYVLLASLCANQRKWGDVRMARSMMRERGIKKTPGSSLIEVEGVFHEFLVGDE 185 LDP DSG YVL++ + A++ KWG V+M R++MR+RG+KK PG S IEV+G FHEFL D Sbjct: 564 LDPSDSGIYVLMSQIYASKSKWGQVKMIRTVMRDRGVKKNPGCSSIEVDGKFHEFLAADV 623 Query: 186 SHPKSKAIYKVLAELLL 236 SH S+ IY L + L Sbjct: 624 SHAHSEDIYAALENIYL 640 >ref|XP_002309169.1| predicted protein [Populus trichocarpa] gi|222855145|gb|EEE92692.1| predicted protein [Populus trichocarpa] Length = 619 Score = 90.5 bits (223), Expect = 1e-16 Identities = 44/76 (57%), Positives = 54/76 (71%) Frame = +3 Query: 6 LDPKDSGTYVLLASLCANQRKWGDVRMARSMMRERGIKKTPGSSLIEVEGVFHEFLVGDE 185 L+P +SG YVLL+++ + KW D RS+M ERGIKK PG S IEV+GV HEFLVGD Sbjct: 445 LEPSNSGNYVLLSNIYSASHKWEDAAKIRSIMSERGIKKVPGYSWIEVDGVVHEFLVGDT 504 Query: 186 SHPKSKAIYKVLAELL 233 SHP S+ IY L EL+ Sbjct: 505 SHPLSEKIYAKLGELV 520