BLASTX nr result
ID: Scutellaria23_contig00024351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00024351 (462 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278661.1| PREDICTED: NAC domain-containing protein 8 [... 63 2e-08 emb|CAN77470.1| hypothetical protein VITISV_029763 [Vitis vinifera] 63 2e-08 ref|XP_002509421.1| NAC domain-containing protein 21/22, putativ... 59 3e-07 ref|XP_002329805.1| NAC domain protein, IPR003441 [Populus trich... 58 9e-07 >ref|XP_002278661.1| PREDICTED: NAC domain-containing protein 8 [Vitis vinifera] Length = 312 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/49 (63%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = -2 Query: 461 SSDFVEYYNPPYISYNQ-NMKRDSPPQLIPNLVVHGDGSSFLHLPSTAS 318 S+ VEYY+P +ISY+Q + R+SPPQLIPNLVV GDGSSF+ L + AS Sbjct: 250 SAALVEYYHPSFISYDQVSHNRESPPQLIPNLVVQGDGSSFIRLAADAS 298 >emb|CAN77470.1| hypothetical protein VITISV_029763 [Vitis vinifera] Length = 796 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/49 (63%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = -2 Query: 461 SSDFVEYYNPPYISYNQ-NMKRDSPPQLIPNLVVHGDGSSFLHLPSTAS 318 S+ VEYY+P +ISY+Q + R+SPPQLIPNLVV GDGSSF+ L + AS Sbjct: 734 SAALVEYYHPSFISYDQVSHNRESPPQLIPNLVVQGDGSSFIRLAADAS 782 >ref|XP_002509421.1| NAC domain-containing protein 21/22, putative [Ricinus communis] gi|223549320|gb|EEF50808.1| NAC domain-containing protein 21/22, putative [Ricinus communis] Length = 305 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/47 (59%), Positives = 36/47 (76%), Gaps = 2/47 (4%) Frame = -2 Query: 452 FVEYYNPPYISYN--QNMKRDSPPQLIPNLVVHGDGSSFLHLPSTAS 318 FV+YYNP +ISY+ ++ R+SPPQLIPNLVV G+GSSF L + S Sbjct: 252 FVDYYNPAFISYDHHESHNRESPPQLIPNLVVQGEGSSFFRLVAETS 298 >ref|XP_002329805.1| NAC domain protein, IPR003441 [Populus trichocarpa] gi|222870867|gb|EEF07998.1| NAC domain protein, IPR003441 [Populus trichocarpa] Length = 310 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 1/49 (2%) Frame = -2 Query: 461 SSDFVEYYNPPYISYNQ-NMKRDSPPQLIPNLVVHGDGSSFLHLPSTAS 318 S+D +E+YNP YISY+Q N + PPQ +PNLVV GDGS F L + S Sbjct: 254 STDLLEFYNPSYISYDQGNYSSEIPPQFLPNLVVQGDGSPFTRLAAETS 302