BLASTX nr result
ID: Scutellaria23_contig00024240
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00024240 (271 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632433.1| PREDICTED: glutathione transferase GST 23 [V... 57 2e-06 ref|XP_002264055.2| PREDICTED: probable glutathione S-transferas... 57 2e-06 ref|XP_003524974.1| PREDICTED: probable glutathione S-transferas... 56 3e-06 gb|ABW81097.1| GST20 [Cleome spinosa] 56 3e-06 ref|XP_002266793.2| PREDICTED: glutathione transferase GST 23 is... 55 5e-06 >ref|XP_003632433.1| PREDICTED: glutathione transferase GST 23 [Vitis vinifera] Length = 233 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = +3 Query: 3 YIEETWLNQTPLLPRDPYDRVMARFWINFGEQKVYN 110 Y+EETW Q PLLP+DPYD+ MARFW FGE KV N Sbjct: 73 YMEETW-PQNPLLPQDPYDKAMARFWAKFGEDKVTN 107 >ref|XP_002264055.2| PREDICTED: probable glutathione S-transferase-like [Vitis vinifera] Length = 225 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/48 (54%), Positives = 33/48 (68%) Frame = +3 Query: 3 YIEETWLNQTPLLPRDPYDRVMARFWINFGEQKVYNL*LLSFAFVPKG 146 YI+ETW +TPLLP DPY+R MARFW FG+ KV+ + FV +G Sbjct: 73 YIDETW-KETPLLPEDPYERAMARFWAKFGDDKVFTS-IFGGVFVKEG 118 >ref|XP_003524974.1| PREDICTED: probable glutathione S-transferase-like [Glycine max] Length = 224 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +3 Query: 3 YIEETWLNQTPLLPRDPYDRVMARFWINFGEQKV 104 YI+ETW Q PLLP+DPY R +ARFW NFGEQK+ Sbjct: 75 YIDETW-KQYPLLPQDPYQRALARFWANFGEQKL 107 >gb|ABW81097.1| GST20 [Cleome spinosa] Length = 221 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/48 (54%), Positives = 32/48 (66%) Frame = +3 Query: 3 YIEETWLNQTPLLPRDPYDRVMARFWINFGEQKVYNL*LLSFAFVPKG 146 YI+ETW Q P+LPRDPYDR MARFW F ++K+ + L S KG Sbjct: 75 YIDETW-TQYPILPRDPYDRAMARFWAKFVDEKIVSAGLKSVVKAEKG 121 >ref|XP_002266793.2| PREDICTED: glutathione transferase GST 23 isoform 2 [Vitis vinifera] Length = 229 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = +3 Query: 3 YIEETWLNQTPLLPRDPYDRVMARFWINFGEQKV 104 Y+EETW Q PLLP+DPYD+ MARFW FGE KV Sbjct: 73 YMEETW-PQNPLLPQDPYDKAMARFWAKFGEDKV 105