BLASTX nr result
ID: Scutellaria23_contig00023841
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00023841 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAD56220.1| ribosomal protein RL5 [Cicer arietinum] 73 3e-11 tpg|DAA46604.1| TPA: hypothetical protein ZEAMMB73_425806 [Zea m... 73 3e-11 ref|XP_003546691.1| PREDICTED: 60S ribosomal protein L11-like is... 73 3e-11 ref|XP_003540015.1| PREDICTED: 60S ribosomal protein L11-like [G... 73 3e-11 ref|XP_003526218.1| PREDICTED: 60S ribosomal protein L11-like [G... 73 3e-11 >emb|CAD56220.1| ribosomal protein RL5 [Cicer arietinum] Length = 181 Score = 72.8 bits (177), Expect = 3e-11 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +3 Query: 108 MASEKKLTNPMREIKVQKLVLNISVGESGDRLTRAAKV 221 MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKV Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKV 38 >tpg|DAA46604.1| TPA: hypothetical protein ZEAMMB73_425806 [Zea mays] Length = 203 Score = 72.8 bits (177), Expect = 3e-11 Identities = 40/57 (70%), Positives = 45/57 (78%) Frame = +3 Query: 51 ISFSRRSSSAALQPYRRSAMASEKKLTNPMREIKVQKLVLNISVGESGDRLTRAAKV 221 I++S SS L S +ASEKK +NPMRE+KVQKLVLNISVGESGDRLTRAAKV Sbjct: 28 IAYSEGSSYIYLGRLHASFVASEKKQSNPMREMKVQKLVLNISVGESGDRLTRAAKV 84 >ref|XP_003546691.1| PREDICTED: 60S ribosomal protein L11-like isoform 2 [Glycine max] Length = 169 Score = 72.8 bits (177), Expect = 3e-11 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +3 Query: 108 MASEKKLTNPMREIKVQKLVLNISVGESGDRLTRAAKV 221 MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKV Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKV 38 >ref|XP_003540015.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max] Length = 181 Score = 72.8 bits (177), Expect = 3e-11 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +3 Query: 108 MASEKKLTNPMREIKVQKLVLNISVGESGDRLTRAAKV 221 MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKV Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKV 38 >ref|XP_003526218.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max] Length = 176 Score = 72.8 bits (177), Expect = 3e-11 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +3 Query: 108 MASEKKLTNPMREIKVQKLVLNISVGESGDRLTRAAKV 221 MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAKV Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKV 38