BLASTX nr result
ID: Scutellaria23_contig00023521
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00023521 (321 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515872.1| Serine/threonine-protein kinase PBS1, putati... 61 1e-07 ref|XP_002270105.1| PREDICTED: probable receptor-like protein ki... 60 2e-07 ref|XP_002298261.1| predicted protein [Populus trichocarpa] gi|2... 58 7e-07 >ref|XP_002515872.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis] gi|223545027|gb|EEF46541.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis] Length = 306 Score = 60.8 bits (146), Expect = 1e-07 Identities = 32/71 (45%), Positives = 45/71 (63%) Frame = -2 Query: 227 ENFILNIRLLFLALFHLRSQPSPPSLLKCFSYKDIKKATDGFKWVINNSSQETTYKANFR 48 + I IR LA RS+ P S ++ FSYKD+K ATDGF+ ++ + S T YKA F+ Sbjct: 6 DRLIRKIRAHLLAWLR-RSRSGPVSFVRRFSYKDLKMATDGFQRIVYSDSHGTAYKARFQ 64 Query: 47 NGCVAIVREVK 15 +G +A+V EVK Sbjct: 65 DGYIALVMEVK 75 >ref|XP_002270105.1| PREDICTED: probable receptor-like protein kinase At1g49730 [Vitis vinifera] gi|296084850|emb|CBI28259.3| unnamed protein product [Vitis vinifera] Length = 301 Score = 60.1 bits (144), Expect = 2e-07 Identities = 33/72 (45%), Positives = 47/72 (65%) Frame = -2 Query: 218 ILNIRLLFLALFHLRSQPSPPSLLKCFSYKDIKKATDGFKWVINNSSQETTYKANFRNGC 39 I RLL LA H + P S ++ FSYKDIK+ATDGF+ + ++S YKA F++G Sbjct: 5 IRKFRLLLLAWLHPH-RSGPVSFVRRFSYKDIKRATDGFRRISYSNSYGVAYKAIFQDGL 63 Query: 38 VAIVREVKLFDE 3 VA+V+EV F++ Sbjct: 64 VALVKEVGDFNQ 75 >ref|XP_002298261.1| predicted protein [Populus trichocarpa] gi|222845519|gb|EEE83066.1| predicted protein [Populus trichocarpa] Length = 300 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/61 (44%), Positives = 44/61 (72%) Frame = -2 Query: 197 FLALFHLRSQPSPPSLLKCFSYKDIKKATDGFKWVINNSSQETTYKANFRNGCVAIVREV 18 +L + RS+ P SL++ SYKD+K+ATDGF+ +I +++ Y+A F++G VA+V+EV Sbjct: 11 YLLAWLRRSRSGPASLVRRLSYKDMKRATDGFRRIIYSNTHGAAYRARFQDGEVALVKEV 70 Query: 17 K 15 K Sbjct: 71 K 71