BLASTX nr result
ID: Scutellaria23_contig00023515
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00023515 (412 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABO92975.1| F-box domain-containing protein [Solanum tuberosum] 63 3e-08 gb|AAT38704.2| F-box domain containing protein, putative [Solanu... 63 3e-08 ref|XP_002518046.1| ubiquitin-protein ligase, putative [Ricinus ... 62 4e-08 gb|ABI34316.1| S haplotype-specific F-box protein, putative [Sol... 62 4e-08 ref|XP_002328907.1| predicted protein [Populus trichocarpa] gi|2... 61 8e-08 >gb|ABO92975.1| F-box domain-containing protein [Solanum tuberosum] Length = 285 Score = 62.8 bits (151), Expect = 3e-08 Identities = 32/53 (60%), Positives = 35/53 (66%) Frame = -2 Query: 219 LPPEIVAKILAKVPPKSLIKFKCVSKSWNSLISSPEFILLHTKQAILSNSLSH 61 LP EI+ KIL KVPPKSL+KF CVSKSW LISS +FI H K SH Sbjct: 9 LPHEIIIKILLKVPPKSLLKFTCVSKSWLELISSTKFIKNHLKSTGNDKECSH 61 >gb|AAT38704.2| F-box domain containing protein, putative [Solanum demissum] Length = 285 Score = 62.8 bits (151), Expect = 3e-08 Identities = 32/53 (60%), Positives = 35/53 (66%) Frame = -2 Query: 219 LPPEIVAKILAKVPPKSLIKFKCVSKSWNSLISSPEFILLHTKQAILSNSLSH 61 LP EI+ KIL KVPPKSL+KF CVSKSW LISS +FI H K SH Sbjct: 9 LPHEIIIKILLKVPPKSLLKFTCVSKSWLELISSTKFIKNHLKSTGNDKECSH 61 >ref|XP_002518046.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223542642|gb|EEF44179.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 257 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/53 (50%), Positives = 42/53 (79%) Frame = -2 Query: 219 LPPEIVAKILAKVPPKSLIKFKCVSKSWNSLISSPEFILLHTKQAILSNSLSH 61 LP +++ +IL++VP K LI+FKC+ K+WNSLIS+PEF L K+A +N++S+ Sbjct: 4 LPQDLITEILSRVPVKPLIRFKCICKTWNSLISNPEFAKLQLKRAKENNNVSN 56 >gb|ABI34316.1| S haplotype-specific F-box protein, putative [Solanum demissum] Length = 190 Score = 62.4 bits (150), Expect = 4e-08 Identities = 30/53 (56%), Positives = 36/53 (67%) Frame = -2 Query: 219 LPPEIVAKILAKVPPKSLIKFKCVSKSWNSLISSPEFILLHTKQAILSNSLSH 61 LP EI+ +IL +PPKSL+KF+CVSKSW LISS +FI H KQ SH Sbjct: 9 LPHEIIKEILLNLPPKSLLKFRCVSKSWLELISSAKFIKNHLKQTANDKEYSH 61 >ref|XP_002328907.1| predicted protein [Populus trichocarpa] gi|222839337|gb|EEE77674.1| predicted protein [Populus trichocarpa] Length = 374 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/58 (46%), Positives = 40/58 (68%) Frame = -2 Query: 234 KMSDNLPPEIVAKILAKVPPKSLIKFKCVSKSWNSLISSPEFILLHTKQAILSNSLSH 61 K LP EI+++IL+++P K L++FKCVSK+W SLIS PEF+ H K+ + +H Sbjct: 3 KKIPKLPSEIISEILSRLPVKCLVRFKCVSKTWRSLISHPEFVKNHLKRTKEDTNANH 60