BLASTX nr result
ID: Scutellaria23_contig00023379
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00023379 (351 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAY34782.1| wall-associated kinase 4 [Triticum aestivum] 64 1e-08 gb|AAY34781.1| wall-associated kinase 2 [Triticum aestivum] 62 6e-08 ref|XP_003581059.1| PREDICTED: wall-associated receptor kinase 2... 59 4e-07 gb|EEC85061.1| hypothetical protein OsI_32397 [Oryza sativa Indi... 59 5e-07 ref|XP_003559866.1| PREDICTED: wall-associated receptor kinase 2... 58 7e-07 >gb|AAY34782.1| wall-associated kinase 4 [Triticum aestivum] Length = 523 Score = 63.9 bits (154), Expect = 1e-08 Identities = 25/39 (64%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = +3 Query: 234 IAKPGCRDRCGEISIPFPFGVG-PNCSLPGFEIICNTST 347 + +PGCRD+CG++SIPFPFG+ P C LPGFE+ CNTS+ Sbjct: 47 LGRPGCRDKCGDMSIPFPFGMDKPGCFLPGFEVTCNTSS 85 >gb|AAY34781.1| wall-associated kinase 2 [Triticum aestivum] Length = 745 Score = 61.6 bits (148), Expect = 6e-08 Identities = 24/39 (61%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = +3 Query: 234 IAKPGCRDRCGEISIPFPFGVG-PNCSLPGFEIICNTST 347 + +PGCRD+CG++SIP PFG+ P C LPGFE+ CNTS+ Sbjct: 47 LGRPGCRDKCGDMSIPLPFGMDKPGCFLPGFEVTCNTSS 85 >ref|XP_003581059.1| PREDICTED: wall-associated receptor kinase 2-like [Brachypodium distachyon] Length = 708 Score = 58.9 bits (141), Expect = 4e-07 Identities = 21/38 (55%), Positives = 30/38 (78%) Frame = +3 Query: 237 AKPGCRDRCGEISIPFPFGVGPNCSLPGFEIICNTSTN 350 A P C +CG++ I +PFG+GP CSLPGF++ C+T+TN Sbjct: 28 AGPNCPTKCGDVDILYPFGIGPGCSLPGFKLTCDTTTN 65 >gb|EEC85061.1| hypothetical protein OsI_32397 [Oryza sativa Indica Group] Length = 383 Score = 58.5 bits (140), Expect = 5e-07 Identities = 21/36 (58%), Positives = 27/36 (75%) Frame = +3 Query: 243 PGCRDRCGEISIPFPFGVGPNCSLPGFEIICNTSTN 350 PGC DRCG++ +PFPFG+ CSL GF + CN +TN Sbjct: 39 PGCPDRCGDVKVPFPFGIRDGCSLAGFGLTCNNATN 74 >ref|XP_003559866.1| PREDICTED: wall-associated receptor kinase 2-like, partial [Brachypodium distachyon] Length = 732 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/39 (61%), Positives = 28/39 (71%) Frame = +3 Query: 234 IAKPGCRDRCGEISIPFPFGVGPNCSLPGFEIICNTSTN 350 I GC D+CG+ISIPFPFG+ P C L GFE+ CN S N Sbjct: 26 ITLAGCPDKCGDISIPFPFGMKPGCFLEGFEVTCNHSFN 64