BLASTX nr result
ID: Scutellaria23_contig00023310
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00023310 (408 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266270.2| PREDICTED: tRNA-specific adenosine deaminase... 66 3e-09 emb|CBI16992.3| unnamed protein product [Vitis vinifera] 66 3e-09 ref|XP_002521753.1| hydrolase, putative [Ricinus communis] gi|22... 62 5e-08 ref|XP_004157874.1| PREDICTED: LOW QUALITY PROTEIN: tRNA-specifi... 60 2e-07 ref|XP_004142032.1| PREDICTED: tRNA-specific adenosine deaminase... 60 2e-07 >ref|XP_002266270.2| PREDICTED: tRNA-specific adenosine deaminase-like protein 3-like [Vitis vinifera] Length = 433 Score = 65.9 bits (159), Expect = 3e-09 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = +2 Query: 317 LSKVCKYAALTKEEWDEQCKLWPTSFHPPT 406 ++KVCKYAAL+KEEW+EQCKLWPTS+HPPT Sbjct: 105 ITKVCKYAALSKEEWEEQCKLWPTSYHPPT 134 >emb|CBI16992.3| unnamed protein product [Vitis vinifera] Length = 402 Score = 65.9 bits (159), Expect = 3e-09 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = +2 Query: 317 LSKVCKYAALTKEEWDEQCKLWPTSFHPPT 406 ++KVCKYAAL+KEEW+EQCKLWPTS+HPPT Sbjct: 105 ITKVCKYAALSKEEWEEQCKLWPTSYHPPT 134 >ref|XP_002521753.1| hydrolase, putative [Ricinus communis] gi|223538966|gb|EEF40563.1| hydrolase, putative [Ricinus communis] Length = 423 Score = 62.0 bits (149), Expect = 5e-08 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +2 Query: 317 LSKVCKYAALTKEEWDEQCKLWPTSFHPPT 406 ++K+CKYAA ++EEW+EQCK WPTSFHPPT Sbjct: 106 ITKICKYAATSREEWEEQCKFWPTSFHPPT 135 >ref|XP_004157874.1| PREDICTED: LOW QUALITY PROTEIN: tRNA-specific adenosine deaminase-like protein 3-like [Cucumis sativus] Length = 410 Score = 60.1 bits (144), Expect = 2e-07 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +2 Query: 317 LSKVCKYAALTKEEWDEQCKLWPTSFHPP 403 ++KVCK AA TKEEW+EQCKLWPTS+HPP Sbjct: 101 ITKVCKEAATTKEEWEEQCKLWPTSYHPP 129 >ref|XP_004142032.1| PREDICTED: tRNA-specific adenosine deaminase-like protein 3-like [Cucumis sativus] Length = 410 Score = 60.1 bits (144), Expect = 2e-07 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +2 Query: 317 LSKVCKYAALTKEEWDEQCKLWPTSFHPP 403 ++KVCK AA TKEEW+EQCKLWPTS+HPP Sbjct: 101 ITKVCKEAATTKEEWEEQCKLWPTSYHPP 129