BLASTX nr result
ID: Scutellaria23_contig00023118
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00023118 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004145247.1| PREDICTED: ataxin-7-like protein 3-like [Cuc... 55 5e-06 >ref|XP_004145247.1| PREDICTED: ataxin-7-like protein 3-like [Cucumis sativus] gi|449472868|ref|XP_004153719.1| PREDICTED: ataxin-7-like protein 3-like [Cucumis sativus] gi|449529992|ref|XP_004171981.1| PREDICTED: ataxin-7-like protein 3-like [Cucumis sativus] Length = 178 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = +3 Query: 45 MSVSKEDDVPFNSEILSNIFGELLDSIIIDVASESHRIARLG 170 MS+ ED+ +++ SN+FG+LLDS+I+D+ASE HRIARLG Sbjct: 1 MSMPNEDNASSQTQLSSNLFGDLLDSVIVDIASECHRIARLG 42