BLASTX nr result
ID: Scutellaria23_contig00023030
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00023030 (470 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002327243.1| predicted protein [Populus trichocarpa] gi|2... 78 9e-13 ref|XP_002874575.1| hypothetical protein ARALYDRAFT_489810 [Arab... 76 2e-12 ref|NP_192696.3| SNARE associated Golgi protein [Arabidopsis tha... 76 2e-12 ref|XP_002325990.1| predicted protein [Populus trichocarpa] gi|2... 76 3e-12 ref|XP_003556197.1| PREDICTED: uncharacterized membrane protein ... 72 5e-11 >ref|XP_002327243.1| predicted protein [Populus trichocarpa] gi|222835613|gb|EEE74048.1| predicted protein [Populus trichocarpa] Length = 262 Score = 77.8 bits (190), Expect = 9e-13 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -1 Query: 470 AGLALGDLQSVKDLYDFKTLAVLFLIGSILLFPTLLKKKRVYE 342 AGLALGDL+SVKDLYDFKTL+VLFLIGSI +FPTLLK+KR+YE Sbjct: 220 AGLALGDLKSVKDLYDFKTLSVLFLIGSISIFPTLLKRKRIYE 262 >ref|XP_002874575.1| hypothetical protein ARALYDRAFT_489810 [Arabidopsis lyrata subsp. lyrata] gi|297320412|gb|EFH50834.1| hypothetical protein ARALYDRAFT_489810 [Arabidopsis lyrata subsp. lyrata] Length = 294 Score = 76.3 bits (186), Expect = 2e-12 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = -1 Query: 470 AGLALGDLQSVKDLYDFKTLAVLFLIGSILLFPTLLKKKRVYE 342 AGLALGDL+SVKDLYDFKTL+VLFLIGSI +FP LLK+KRVYE Sbjct: 252 AGLALGDLRSVKDLYDFKTLSVLFLIGSISIFPALLKRKRVYE 294 >ref|NP_192696.3| SNARE associated Golgi protein [Arabidopsis thaliana] gi|75153817|sp|Q8L586.1|Y4958_ARATH RecName: Full=Uncharacterized membrane protein At4g09580 gi|20465630|gb|AAM20146.1| unknown protein [Arabidopsis thaliana] gi|21281237|gb|AAM45090.1| unknown protein [Arabidopsis thaliana] gi|332657367|gb|AEE82767.1| SNARE associated Golgi protein [Arabidopsis thaliana] Length = 287 Score = 76.3 bits (186), Expect = 2e-12 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = -1 Query: 470 AGLALGDLQSVKDLYDFKTLAVLFLIGSILLFPTLLKKKRVYE 342 AGLALGDL+SVKDLYDFKTL+VLFLIGSI +FP LLK+KRVYE Sbjct: 245 AGLALGDLRSVKDLYDFKTLSVLFLIGSISIFPALLKRKRVYE 287 >ref|XP_002325990.1| predicted protein [Populus trichocarpa] gi|222862865|gb|EEF00372.1| predicted protein [Populus trichocarpa] Length = 262 Score = 75.9 bits (185), Expect = 3e-12 Identities = 35/43 (81%), Positives = 42/43 (97%) Frame = -1 Query: 470 AGLALGDLQSVKDLYDFKTLAVLFLIGSILLFPTLLKKKRVYE 342 AGLALGDL+SVKDLYD+KTL+VLF+IGSI +FPTLLK+KR+YE Sbjct: 220 AGLALGDLKSVKDLYDYKTLSVLFIIGSISIFPTLLKRKRIYE 262 >ref|XP_003556197.1| PREDICTED: uncharacterized membrane protein At4g09580-like [Glycine max] Length = 271 Score = 72.0 bits (175), Expect = 5e-11 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = -1 Query: 470 AGLALGDLQSVKDLYDFKTLAVLFLIGSILLFPTLLKKKRVYE 342 AGLALGDL+S+KDLYDFKTL+VLFLIG + + PTLLK+KRVYE Sbjct: 229 AGLALGDLKSIKDLYDFKTLSVLFLIGFVSIAPTLLKRKRVYE 271