BLASTX nr result
ID: Scutellaria23_contig00022296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00022296 (303 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513609.1| conserved hypothetical protein [Ricinus comm... 137 1e-30 ref|XP_002460536.1| hypothetical protein SORBIDRAFT_02g030100 [S... 136 2e-30 ref|XP_004142440.1| PREDICTED: cytochrome c oxidase assembly fac... 135 4e-30 ref|XP_003578454.1| PREDICTED: cytochrome c oxidase assembly fac... 135 4e-30 ref|XP_002315392.1| predicted protein [Populus trichocarpa] gi|2... 134 6e-30 >ref|XP_002513609.1| conserved hypothetical protein [Ricinus communis] gi|223547517|gb|EEF49012.1| conserved hypothetical protein [Ricinus communis] Length = 71 Score = 137 bits (344), Expect = 1e-30 Identities = 64/71 (90%), Positives = 67/71 (94%) Frame = -1 Query: 288 MAKSCKGLAMELVKCLSESDCVKVENRPYRDCAKEKTPKISSECVGLRETYFNCKRGQVD 109 MAKSCKGLAMELVKCLSESDCVKVE RPYR+CA EK+P I SECVGLRETYFNCKRGQ+D Sbjct: 1 MAKSCKGLAMELVKCLSESDCVKVEKRPYRECAGEKSPCIPSECVGLRETYFNCKRGQLD 60 Query: 108 MRARIRGNKGY 76 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_002460536.1| hypothetical protein SORBIDRAFT_02g030100 [Sorghum bicolor] gi|241923913|gb|EER97057.1| hypothetical protein SORBIDRAFT_02g030100 [Sorghum bicolor] gi|414589991|tpg|DAA40562.1| TPA: hypothetical protein ZEAMMB73_292465 [Zea mays] Length = 71 Score = 136 bits (342), Expect = 2e-30 Identities = 62/71 (87%), Positives = 67/71 (94%) Frame = -1 Query: 288 MAKSCKGLAMELVKCLSESDCVKVENRPYRDCAKEKTPKISSECVGLRETYFNCKRGQVD 109 MAKSCKGLAMELVKCLSE+DCVKV+ RPY++CA EK P I+SECVGLRETYFNCKRGQVD Sbjct: 1 MAKSCKGLAMELVKCLSETDCVKVQKRPYKECAGEKVPNITSECVGLRETYFNCKRGQVD 60 Query: 108 MRARIRGNKGY 76 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_004142440.1| PREDICTED: cytochrome c oxidase assembly factor 5-like [Cucumis sativus] gi|449487146|ref|XP_004157510.1| PREDICTED: cytochrome c oxidase assembly factor 5-like [Cucumis sativus] Length = 71 Score = 135 bits (339), Expect = 4e-30 Identities = 63/71 (88%), Positives = 67/71 (94%) Frame = -1 Query: 288 MAKSCKGLAMELVKCLSESDCVKVENRPYRDCAKEKTPKISSECVGLRETYFNCKRGQVD 109 M+KSCKGLAMELVKCLSESDCVKV+NR YR+CA EK+P I SECVGLRETYFNCKRGQVD Sbjct: 1 MSKSCKGLAMELVKCLSESDCVKVQNRTYRECAGEKSPCIPSECVGLRETYFNCKRGQVD 60 Query: 108 MRARIRGNKGY 76 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_003578454.1| PREDICTED: cytochrome c oxidase assembly factor 5-like [Brachypodium distachyon] gi|326497105|dbj|BAK02137.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 71 Score = 135 bits (339), Expect = 4e-30 Identities = 61/71 (85%), Positives = 67/71 (94%) Frame = -1 Query: 288 MAKSCKGLAMELVKCLSESDCVKVENRPYRDCAKEKTPKISSECVGLRETYFNCKRGQVD 109 M+KSCKGLAMELVKCLSE+DCVKV+ RPY++CA EK P I+SECVGLRETYFNCKRGQVD Sbjct: 1 MSKSCKGLAMELVKCLSETDCVKVQKRPYKECAGEKAPNITSECVGLRETYFNCKRGQVD 60 Query: 108 MRARIRGNKGY 76 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_002315392.1| predicted protein [Populus trichocarpa] gi|222864432|gb|EEF01563.1| predicted protein [Populus trichocarpa] Length = 71 Score = 134 bits (338), Expect = 6e-30 Identities = 60/71 (84%), Positives = 68/71 (95%) Frame = -1 Query: 288 MAKSCKGLAMELVKCLSESDCVKVENRPYRDCAKEKTPKISSECVGLRETYFNCKRGQVD 109 M+KSCKGLA+ELVKCLSESDC+K+E+RPY++CA EK+P I SECVGLRETYFNCKRGQVD Sbjct: 1 MSKSCKGLALELVKCLSESDCIKMEDRPYKECAGEKSPSIPSECVGLRETYFNCKRGQVD 60 Query: 108 MRARIRGNKGY 76 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71