BLASTX nr result
ID: Scutellaria23_contig00022284
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00022284 (383 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADL36702.1| GRF domain class transcription factor [Malus x do... 64 1e-08 ref|XP_002534110.1| conserved hypothetical protein [Ricinus comm... 61 8e-08 ref|XP_002864265.1| AtGRF7 [Arabidopsis lyrata subsp. lyrata] gi... 60 2e-07 gb|ACB31280.1| GRL7 [Arabidopsis thaliana] gi|170678454|gb|ACB31... 60 2e-07 gb|ACB31279.1| GRL7 [Arabidopsis thaliana] gi|170678442|gb|ACB31... 60 2e-07 >gb|ADL36702.1| GRF domain class transcription factor [Malus x domestica] Length = 394 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = -3 Query: 381 DGKKWRCNKSVVNGQKYCHRHVHRGRLRSDHHLQPPSASTAATT 250 DGKKWRC++ VV GQKYC RHVHRGR RS ++ + +TAATT Sbjct: 156 DGKKWRCSRDVVAGQKYCERHVHRGRNRSRKPVEVATTTTAATT 199 >ref|XP_002534110.1| conserved hypothetical protein [Ricinus communis] gi|223525833|gb|EEF28270.1| conserved hypothetical protein [Ricinus communis] Length = 428 Score = 61.2 bits (147), Expect = 8e-08 Identities = 25/44 (56%), Positives = 34/44 (77%) Frame = -3 Query: 381 DGKKWRCNKSVVNGQKYCHRHVHRGRLRSDHHLQPPSASTAATT 250 DGKKWRC++ VV GQKYC RHVHRGR RS ++ P+ +++ +T Sbjct: 176 DGKKWRCSRDVVAGQKYCERHVHRGRNRSRKPVEIPTTNSSTST 219 >ref|XP_002864265.1| AtGRF7 [Arabidopsis lyrata subsp. lyrata] gi|297310100|gb|EFH40524.1| AtGRF7 [Arabidopsis lyrata subsp. lyrata] Length = 369 Score = 59.7 bits (143), Expect = 2e-07 Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = -3 Query: 381 DGKKWRCNKSVVNGQKYCHRHVHRGRLRSDHHLQPP 274 DGKKWRC K VV+ KYC +H+HRGR RS H++PP Sbjct: 120 DGKKWRCAKEVVSNHKYCEKHLHRGRPRSRKHVEPP 155 >gb|ACB31280.1| GRL7 [Arabidopsis thaliana] gi|170678454|gb|ACB31287.1| GRL7 [Arabidopsis thaliana] Length = 145 Score = 59.7 bits (143), Expect = 2e-07 Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = -3 Query: 381 DGKKWRCNKSVVNGQKYCHRHVHRGRLRSDHHLQPP 274 DGKKWRC K VV+ KYC +H+HRGR RS H++PP Sbjct: 62 DGKKWRCAKEVVSNHKYCEKHLHRGRPRSRKHVEPP 97 >gb|ACB31279.1| GRL7 [Arabidopsis thaliana] gi|170678442|gb|ACB31281.1| GRL7 [Arabidopsis thaliana] gi|170678444|gb|ACB31282.1| GRL7 [Arabidopsis thaliana] gi|170678446|gb|ACB31283.1| GRL7 [Arabidopsis thaliana] gi|170678448|gb|ACB31284.1| GRL7 [Arabidopsis thaliana] gi|170678450|gb|ACB31285.1| GRL7 [Arabidopsis thaliana] gi|170678452|gb|ACB31286.1| GRL7 [Arabidopsis thaliana] gi|170678456|gb|ACB31288.1| GRL7 [Arabidopsis thaliana] gi|170678458|gb|ACB31289.1| GRL7 [Arabidopsis thaliana] gi|170678460|gb|ACB31290.1| GRL7 [Arabidopsis thaliana] gi|170678462|gb|ACB31291.1| GRL7 [Arabidopsis thaliana] gi|170678464|gb|ACB31292.1| GRL7 [Arabidopsis thaliana] gi|170678466|gb|ACB31293.1| GRL7 [Arabidopsis thaliana] gi|170678468|gb|ACB31294.1| GRL7 [Arabidopsis thaliana] gi|170678470|gb|ACB31295.1| GRL7 [Arabidopsis thaliana] gi|170678472|gb|ACB31296.1| GRL7 [Arabidopsis thaliana] gi|170678474|gb|ACB31297.1| GRL7 [Arabidopsis thaliana] gi|170678476|gb|ACB31298.1| GRL7 [Arabidopsis thaliana] gi|170678478|gb|ACB31299.1| GRL7 [Arabidopsis thaliana] gi|170678480|gb|ACB31300.1| GRL7 [Arabidopsis thaliana] Length = 145 Score = 59.7 bits (143), Expect = 2e-07 Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = -3 Query: 381 DGKKWRCNKSVVNGQKYCHRHVHRGRLRSDHHLQPP 274 DGKKWRC K VV+ KYC +H+HRGR RS H++PP Sbjct: 62 DGKKWRCAKEVVSNHKYCEKHLHRGRPRSRKHVEPP 97