BLASTX nr result
ID: Scutellaria23_contig00022276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00022276 (201 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799... 57 2e-06 >ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799960 [Glycine max] gi|356564302|ref|XP_003550394.1| PREDICTED: uncharacterized protein LOC100799844 [Glycine max] Length = 41 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = +3 Query: 99 EILLFHFMINSYRRRSTHLVQSFSVVFLYWFYVF 200 EIL FMINS RR THLVQSFSVVFLYWFYVF Sbjct: 7 EILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVF 40