BLASTX nr result
ID: Scutellaria23_contig00022216
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00022216 (307 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300317.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|XP_002300316.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|XP_004147542.1| PREDICTED: MADS-box transcription factor 27-... 56 3e-06 emb|CAN68105.1| hypothetical protein VITISV_002570 [Vitis vinifera] 56 3e-06 emb|CBI35415.3| unnamed protein product [Vitis vinifera] 55 4e-06 >ref|XP_002300317.1| predicted protein [Populus trichocarpa] gi|222847575|gb|EEE85122.1| predicted protein [Populus trichocarpa] Length = 236 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = +2 Query: 170 LSEYCRQLLGEELSGLSIKDLQKLECQIEKSLKDVQMKKVNVLS 301 L EY RQL+GEELSGLSIKDL+ LE Q+EKS+K V++KK +L+ Sbjct: 103 LKEYHRQLMGEELSGLSIKDLENLENQLEKSMKGVRIKKEQILT 146 >ref|XP_002300316.1| predicted protein [Populus trichocarpa] gi|222847574|gb|EEE85121.1| predicted protein [Populus trichocarpa] Length = 238 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = +2 Query: 170 LSEYCRQLLGEELSGLSIKDLQKLECQIEKSLKDVQMKKVNVLS 301 L EY RQL+GEELSGLSIKDL+ LE Q+EKS+K V++KK +L+ Sbjct: 103 LKEYHRQLMGEELSGLSIKDLENLENQLEKSMKGVRIKKEQILT 146 >ref|XP_004147542.1| PREDICTED: MADS-box transcription factor 27-like [Cucumis sativus] Length = 239 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +2 Query: 170 LSEYCRQLLGEELSGLSIKDLQKLECQIEKSLKDVQMKKVNVLS 301 L E RQL+GEELSGLS+KDLQ LE Q+E SLK V++KK LS Sbjct: 103 LQECHRQLMGEELSGLSVKDLQNLESQLEMSLKGVRVKKEKTLS 146 >emb|CAN68105.1| hypothetical protein VITISV_002570 [Vitis vinifera] Length = 123 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = +2 Query: 179 YC-RQLLGEELSGLSIKDLQKLECQIEKSLKDVQMKKVNVL 298 YC RQ++GEELSGLS+KDLQ LE Q+E SL+ V+MKK N+L Sbjct: 7 YCGRQMMGEELSGLSVKDLQNLENQLEMSLRGVRMKKGNLL 47 >emb|CBI35415.3| unnamed protein product [Vitis vinifera] Length = 237 Score = 55.5 bits (132), Expect = 4e-06 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +2 Query: 170 LSEYCRQLLGEELSGLSIKDLQKLECQIEKSLKDVQMKKVNVLS 301 L + RQLLGEELSGL IKDLQ LE Q+E SLK V+MKK +L+ Sbjct: 103 LQDTHRQLLGEELSGLGIKDLQNLENQLEMSLKGVRMKKEKILT 146