BLASTX nr result
ID: Scutellaria23_contig00022181
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00022181 (367 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACK56117.1| ELF4-like protein [Lactuca serriola] 59 4e-07 ref|NP_001235965.1| uncharacterized protein LOC100305734 [Glycin... 57 2e-06 ref|NP_001237475.1| ELF4-like protein [Glycine max] gi|217794291... 57 2e-06 ref|XP_003627239.1| ELF4-like protein [Medicago truncatula] gi|2... 57 2e-06 ref|XP_002521338.1| conserved hypothetical protein [Ricinus comm... 55 4e-06 >gb|ACK56117.1| ELF4-like protein [Lactuca serriola] Length = 113 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/44 (65%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -3 Query: 365 NNNIRRVVDLYANLSDS-AKSIEASSEGESDGTTKAGGQKRVRS 237 NNN++RVVDLY +LS+S +KS++ASSE ES GTT++ G+KRVRS Sbjct: 69 NNNVKRVVDLYGDLSNSFSKSMDASSEAESGGTTRSDGKKRVRS 112 >ref|NP_001235965.1| uncharacterized protein LOC100305734 [Glycine max] gi|255626471|gb|ACU13580.1| unknown [Glycine max] Length = 114 Score = 57.0 bits (136), Expect = 2e-06 Identities = 33/48 (68%), Positives = 39/48 (81%), Gaps = 4/48 (8%) Frame = -3 Query: 365 NNNIRRVVDLYANLSDS-AKSIEASSEGESDGTTKAGG---QKRVRSS 234 N+NIRRVVDLYA+LS+S KS EASSEG+S GT K+ G QKR+RSS Sbjct: 67 NSNIRRVVDLYADLSNSFTKSREASSEGDSSGTLKSDGKVNQKRIRSS 114 >ref|NP_001237475.1| ELF4-like protein [Glycine max] gi|217794291|gb|ACK56126.1| ELF4-like protein [Glycine max] Length = 63 Score = 57.0 bits (136), Expect = 2e-06 Identities = 33/48 (68%), Positives = 39/48 (81%), Gaps = 4/48 (8%) Frame = -3 Query: 365 NNNIRRVVDLYANLSDS-AKSIEASSEGESDGTTKAGG---QKRVRSS 234 N+NIRRVVDLYA+LS+S KS EASSEG+S GT K+ G QKR+RSS Sbjct: 16 NSNIRRVVDLYADLSNSFTKSREASSEGDSSGTLKSDGKVNQKRIRSS 63 >ref|XP_003627239.1| ELF4-like protein [Medicago truncatula] gi|217794046|gb|ACK56118.1| ELF4-like protein [Medicago truncatula] gi|355521261|gb|AET01715.1| ELF4-like protein [Medicago truncatula] gi|388506094|gb|AFK41113.1| unknown [Medicago truncatula] Length = 114 Score = 56.6 bits (135), Expect = 2e-06 Identities = 33/48 (68%), Positives = 38/48 (79%), Gaps = 4/48 (8%) Frame = -3 Query: 365 NNNIRRVVDLYANLSDS-AKSIEASSEGESDGTTKAGG---QKRVRSS 234 N+NIRRVVDLYA+LS S KS EASSEG+S GT K+ G QKR+RSS Sbjct: 67 NSNIRRVVDLYADLSSSFTKSREASSEGDSSGTLKSDGKVNQKRIRSS 114 >ref|XP_002521338.1| conserved hypothetical protein [Ricinus communis] gi|223539416|gb|EEF41006.1| conserved hypothetical protein [Ricinus communis] Length = 114 Score = 55.5 bits (132), Expect = 4e-06 Identities = 31/47 (65%), Positives = 38/47 (80%), Gaps = 4/47 (8%) Frame = -3 Query: 365 NNNIRRVVDLYANLSDS-AKSIEASSEGESDGTTKA---GGQKRVRS 237 NNNIRRVVDLYA+LS + ++S+EASSEGES G K+ G QKR+RS Sbjct: 67 NNNIRRVVDLYADLSTNFSRSMEASSEGESSGILKSNGKGNQKRIRS 113