BLASTX nr result
ID: Scutellaria23_contig00022159
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00022159 (214 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGD98930.1| NBS type disease resistance protein [Malus x dome... 57 2e-06 >gb|AGD98930.1| NBS type disease resistance protein [Malus x domestica] Length = 878 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/47 (55%), Positives = 37/47 (78%) Frame = +1 Query: 1 CRKLGALPEEIESITTLQELEIKMMRETFVNQLRGVDFYKVQHIPTI 141 C+KL LPEEI+S+TTLQEL + M F+++L+G D +KVQH+P+I Sbjct: 829 CQKLRMLPEEIKSLTTLQELVFEGMPRRFIDRLQGEDRHKVQHVPSI 875