BLASTX nr result
ID: Scutellaria23_contig00022138
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00022138 (228 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEL30041.1| polymerase polyprotein [Dahlia common mosaic virus] 60 2e-07 gb|ABW81763.1| reverse transcriptase [Dahlia mosaic virus-Holland] 60 2e-07 ref|NP_659397.1| hypothetical protein [Mirabilis mosaic virus] g... 60 2e-07 gb|AEB54984.1| polyprotein [Dahlia mosaic virus D10] 57 2e-06 gb|AEA39176.1| polyprotein [Dahlia mosaic virus] 56 3e-06 >gb|AEL30041.1| polymerase polyprotein [Dahlia common mosaic virus] Length = 673 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Frame = -2 Query: 224 LVLYTDASDHWWAAVLMKATPDG-EMPCRYCSGLFPDSEAKWHINEKEFFAVRKAFKKW 51 L++ TDASDH+W VL T +G E+ CRY SG F +E +H NEKE AV++ K+ Sbjct: 541 LIIETDASDHFWGGVLKAQTTEGNELICRYSSGTFKPAELNYHSNEKELLAVKQVITKF 599 >gb|ABW81763.1| reverse transcriptase [Dahlia mosaic virus-Holland] Length = 673 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Frame = -2 Query: 224 LVLYTDASDHWWAAVLMKATPDG-EMPCRYCSGLFPDSEAKWHINEKEFFAVRKAFKKW 51 L++ TDASDH+W VL T +G E+ CRY SG F +E +H NEKE AV++ K+ Sbjct: 541 LIIETDASDHFWGGVLKAQTTEGNELICRYSSGTFKPAELNYHSNEKELLAVKQVITKF 599 >ref|NP_659397.1| hypothetical protein [Mirabilis mosaic virus] gi|21427196|gb|AAM53128.1| ORFV [Mirabilis mosaic virus] Length = 674 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Frame = -2 Query: 224 LVLYTDASDHWWAAVLMKATPDGE-MPCRYCSGLFPDSEAKWHINEKEFFAVRKAFKKW 51 L++ TDASDH+W VL T +GE + CRY SG F +E +H NEKE AV++ K+ Sbjct: 539 LIIETDASDHFWGGVLKAQTTEGEELICRYSSGTFKPAELNYHSNEKELLAVKQVITKF 597 >gb|AEB54984.1| polyprotein [Dahlia mosaic virus D10] Length = 810 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/58 (44%), Positives = 35/58 (60%) Frame = -2 Query: 224 LVLYTDASDHWWAAVLMKATPDGEMPCRYCSGLFPDSEAKWHINEKEFFAVRKAFKKW 51 L++ TDAS+ +W VL T + E CRY SG F +E +H NEKE AV+ A K+ Sbjct: 684 LIIETDASNDYWGGVLKAKTAEKEEVCRYTSGSFKTAEKNYHSNEKELLAVKNAISKF 741 >gb|AEA39176.1| polyprotein [Dahlia mosaic virus] Length = 808 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/58 (44%), Positives = 34/58 (58%) Frame = -2 Query: 224 LVLYTDASDHWWAAVLMKATPDGEMPCRYCSGLFPDSEAKWHINEKEFFAVRKAFKKW 51 L++ TDAS+ +W VL T D E CRY SG F +E +H NEKE AV+ K+ Sbjct: 682 LIIETDASNDFWGGVLKAKTADKEEVCRYTSGSFKTAEKNYHSNEKELLAVKNTISKF 739