BLASTX nr result
ID: Scutellaria23_contig00022125
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00022125 (241 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278433.2| PREDICTED: BTB/POZ and TAZ domain-containing... 141 5e-32 emb|CBI24713.3| unnamed protein product [Vitis vinifera] 141 5e-32 emb|CAN79405.1| hypothetical protein VITISV_000709 [Vitis vinifera] 141 5e-32 ref|XP_002323915.1| hypothetical protein POPTRDRAFT_825456 [Popu... 133 2e-29 ref|XP_002534409.1| protein binding protein, putative [Ricinus c... 132 2e-29 >ref|XP_002278433.2| PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Vitis vinifera] Length = 410 Score = 141 bits (356), Expect = 5e-32 Identities = 65/72 (90%), Positives = 69/72 (95%) Frame = +1 Query: 1 RKQERLKKIEERKVYIQLHEAMEALLHICRDGCRTIGPRDKVLKGSQVKCGFPACKGLET 180 RK+ERLKKIEE+KVY+QLHEAMEALLHICRDGCRTIGPRDKVLKGSQV CGFPACKGLET Sbjct: 264 RKEERLKKIEEKKVYLQLHEAMEALLHICRDGCRTIGPRDKVLKGSQVACGFPACKGLET 323 Query: 181 LIRHFSGCKTLV 216 L+RHFS CKT V Sbjct: 324 LVRHFSSCKTRV 335 >emb|CBI24713.3| unnamed protein product [Vitis vinifera] Length = 407 Score = 141 bits (356), Expect = 5e-32 Identities = 65/72 (90%), Positives = 69/72 (95%) Frame = +1 Query: 1 RKQERLKKIEERKVYIQLHEAMEALLHICRDGCRTIGPRDKVLKGSQVKCGFPACKGLET 180 RK+ERLKKIEE+KVY+QLHEAMEALLHICRDGCRTIGPRDKVLKGSQV CGFPACKGLET Sbjct: 261 RKEERLKKIEEKKVYLQLHEAMEALLHICRDGCRTIGPRDKVLKGSQVACGFPACKGLET 320 Query: 181 LIRHFSGCKTLV 216 L+RHFS CKT V Sbjct: 321 LVRHFSSCKTRV 332 >emb|CAN79405.1| hypothetical protein VITISV_000709 [Vitis vinifera] Length = 306 Score = 141 bits (356), Expect = 5e-32 Identities = 65/72 (90%), Positives = 69/72 (95%) Frame = +1 Query: 1 RKQERLKKIEERKVYIQLHEAMEALLHICRDGCRTIGPRDKVLKGSQVKCGFPACKGLET 180 RK+ERLKKIEE+KVY+QLHEAMEALLHICRDGCRTIGPRDKVLKGSQV CGFPACKGLET Sbjct: 160 RKEERLKKIEEKKVYLQLHEAMEALLHICRDGCRTIGPRDKVLKGSQVACGFPACKGLET 219 Query: 181 LIRHFSGCKTLV 216 L+RHFS CKT V Sbjct: 220 LVRHFSSCKTRV 231 >ref|XP_002323915.1| hypothetical protein POPTRDRAFT_825456 [Populus trichocarpa] gi|222866917|gb|EEF04048.1| hypothetical protein POPTRDRAFT_825456 [Populus trichocarpa] Length = 363 Score = 133 bits (334), Expect = 2e-29 Identities = 61/72 (84%), Positives = 67/72 (93%) Frame = +1 Query: 1 RKQERLKKIEERKVYIQLHEAMEALLHICRDGCRTIGPRDKVLKGSQVKCGFPACKGLET 180 RKQERL+KIEERKVY+QL+EAMEALLHICRDGCRTIGP DK+LKGSQV C FPACKGLE+ Sbjct: 217 RKQERLRKIEERKVYLQLYEAMEALLHICRDGCRTIGPSDKMLKGSQVPCNFPACKGLES 276 Query: 181 LIRHFSGCKTLV 216 L+RHFS CKT V Sbjct: 277 LVRHFSNCKTRV 288 >ref|XP_002534409.1| protein binding protein, putative [Ricinus communis] gi|223525356|gb|EEF27978.1| protein binding protein, putative [Ricinus communis] Length = 414 Score = 132 bits (333), Expect = 2e-29 Identities = 60/72 (83%), Positives = 67/72 (93%) Frame = +1 Query: 1 RKQERLKKIEERKVYIQLHEAMEALLHICRDGCRTIGPRDKVLKGSQVKCGFPACKGLET 180 RKQERL+K+EE+KVY+QL+EAMEALLHIC+DGCRTIGPRDKVLKGSQV C FPACKGLE Sbjct: 265 RKQERLRKMEEKKVYLQLYEAMEALLHICKDGCRTIGPRDKVLKGSQVTCNFPACKGLEN 324 Query: 181 LIRHFSGCKTLV 216 L+RHFS CKT V Sbjct: 325 LVRHFSNCKTRV 336