BLASTX nr result
ID: Scutellaria23_contig00021974
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00021974 (734 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P25469.1|H2A1_SOLLC RecName: Full=Histone H2A.1; AltName: Ful... 197 2e-48 dbj|BAL49713.1| fusion protein of histone 2A and enhanced yellow... 197 2e-48 dbj|BAC53941.1| H2A histone [Nicotiana tabacum] 195 7e-48 gb|ACG30088.1| histone H2A [Zea mays] 191 1e-46 gb|ACN26769.1| unknown [Zea mays] gi|413956147|gb|AFW88796.1| hi... 190 2e-46 >sp|P25469.1|H2A1_SOLLC RecName: Full=Histone H2A.1; AltName: Full=LeH2A-1 gi|355477218|gb|AES12482.1| putative histone 2A protein [Solanum lycopersicum] Length = 146 Score = 197 bits (500), Expect = 2e-48 Identities = 110/175 (62%), Positives = 124/175 (70%), Gaps = 3/175 (1%) Frame = +3 Query: 99 VDTNTTTKFAXXXXXXXXKKAIPKSVKAGLQFPVGRIARFLKRGRYAQRMGTGAPIYMAA 278 +D TTK A KK++ KS+KAGLQFPVGRI R+LK+GRYAQR+G+GAPIY+AA Sbjct: 1 MDATKTTKGAGGRKGGPRKKSVTKSIKAGLQFPVGRIGRYLKKGRYAQRVGSGAPIYLAA 60 Query: 279 VLEYLAAEVTFPI*ICFLIRLLKFLSKCLIKCLCEMQVLELAGNAARDNKKSRIIPRHVQ 458 VLEYLAAEV LELAGNAARDNKKSRIIPRHV Sbjct: 61 VLEYLAAEV-----------------------------LELAGNAARDNKKSRIIPRHVL 91 Query: 459 LAIRNDDELGKLLNGVTIASGGVLPNINPVLLPKKSAVSENKAPQM---KSPSKA 614 LA+RND+ELGKLL GVTIASGGVLPNINPVLLPKKSAV+E K+P+ KSP KA Sbjct: 92 LAVRNDEELGKLLAGVTIASGGVLPNINPVLLPKKSAVAEEKSPKAKAGKSPKKA 146 >dbj|BAL49713.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00001] gi|374428674|dbj|BAL49716.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00002] gi|374428678|dbj|BAL49719.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00003] gi|374428682|dbj|BAL49722.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00004] gi|374428686|dbj|BAL49725.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00005] gi|374428690|dbj|BAL49728.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00006] gi|374428694|dbj|BAL49731.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00007] gi|374428698|dbj|BAL49734.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00008] gi|374428702|dbj|BAL49737.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00009] gi|374428706|dbj|BAL49740.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00010] gi|374428710|dbj|BAL49743.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00011] gi|374428714|dbj|BAL49746.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00012] gi|374428718|dbj|BAL49749.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00013] gi|374428722|dbj|BAL49752.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00014] gi|374428726|dbj|BAL49755.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00015] gi|374428730|dbj|BAL49758.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00016] gi|374428734|dbj|BAL49761.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00017] gi|374428738|dbj|BAL49764.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00018] gi|374428742|dbj|BAL49767.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00019] gi|374428748|dbj|BAL49770.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00020] gi|374428752|dbj|BAL49773.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00021] gi|374428756|dbj|BAL49776.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00022] gi|374428760|dbj|BAL49779.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00023] gi|374428764|dbj|BAL49782.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00024] gi|374428768|dbj|BAL49785.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00025] gi|374428772|dbj|BAL49788.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00026] gi|374428776|dbj|BAL49791.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00027] gi|374428780|dbj|BAL49794.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00028] gi|374428784|dbj|BAL49797.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00029] gi|374428788|dbj|BAL49800.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00030] gi|374428792|dbj|BAL49803.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00031] gi|374428796|dbj|BAL49806.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00032] Length = 387 Score = 197 bits (500), Expect = 2e-48 Identities = 110/175 (62%), Positives = 124/175 (70%), Gaps = 3/175 (1%) Frame = +3 Query: 99 VDTNTTTKFAXXXXXXXXKKAIPKSVKAGLQFPVGRIARFLKRGRYAQRMGTGAPIYMAA 278 +D TTK A KK++ KS+KAGLQFPVGRI R+LK+GRYAQR+G+GAPIY+AA Sbjct: 1 MDATKTTKGAGGRKGGPRKKSVTKSIKAGLQFPVGRIGRYLKKGRYAQRVGSGAPIYLAA 60 Query: 279 VLEYLAAEVTFPI*ICFLIRLLKFLSKCLIKCLCEMQVLELAGNAARDNKKSRIIPRHVQ 458 VLEYLAAEV LELAGNAARDNKKSRIIPRHV Sbjct: 61 VLEYLAAEV-----------------------------LELAGNAARDNKKSRIIPRHVL 91 Query: 459 LAIRNDDELGKLLNGVTIASGGVLPNINPVLLPKKSAVSENKAPQM---KSPSKA 614 LA+RND+ELGKLL GVTIASGGVLPNINPVLLPKKSAV+E K+P+ KSP KA Sbjct: 92 LAVRNDEELGKLLAGVTIASGGVLPNINPVLLPKKSAVAEEKSPKAKAGKSPKKA 146 >dbj|BAC53941.1| H2A histone [Nicotiana tabacum] Length = 148 Score = 195 bits (496), Expect = 7e-48 Identities = 112/177 (63%), Positives = 122/177 (68%), Gaps = 3/177 (1%) Frame = +3 Query: 93 MEVDTNTTTKFAXXXXXXXXKKAIPKSVKAGLQFPVGRIARFLKRGRYAQRMGTGAPIYM 272 ME T TT KK++ KSVKAGLQFPVGRIARFLK+GRYAQR+G+GAPIY+ Sbjct: 1 MEAATKTTKGAGGRKGGGPRKKSVTKSVKAGLQFPVGRIARFLKKGRYAQRVGSGAPIYL 60 Query: 273 AAVLEYLAAEVTFPI*ICFLIRLLKFLSKCLIKCLCEMQVLELAGNAARDNKKSRIIPRH 452 AAVLEYLAAEV LELAGNAARDNKKSRIIPRH Sbjct: 61 AAVLEYLAAEV-----------------------------LELAGNAARDNKKSRIIPRH 91 Query: 453 VQLAIRNDDELGKLLNGVTIASGGVLPNINPVLLPKKSAVSENKA---PQMKSPSKA 614 V LA+RND+ELGKLL+GVTIASGGVLPNINPVLLPKKSA +E KA KSP KA Sbjct: 92 VLLAVRNDEELGKLLSGVTIASGGVLPNINPVLLPKKSAAAEEKASTPKATKSPKKA 148 >gb|ACG30088.1| histone H2A [Zea mays] Length = 191 Score = 191 bits (486), Expect = 1e-46 Identities = 105/159 (66%), Positives = 125/159 (78%), Gaps = 5/159 (3%) Frame = +3 Query: 153 KKAIPKSVKAGLQFPVGRIARFLKRGRYAQRMGTGAPIYMAAVLEYLAAEVT-FPI*ICF 329 KK++ +SVKAGLQFPVGRI R+LK+GRYAQR+GTGAP+Y+AAVLEYLAAEV F F Sbjct: 26 KKSVSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLQFEPSSLF 85 Query: 330 LIRLLKFLSKCLIKCLCEM--QVLELAGNAARDNKKSRIIPRHVQLAIRNDDELGKLLNG 503 ++ + ++ C+ + QVLELAGNAARDNKK+RIIPRHV LAIRND+ELGKLL G Sbjct: 86 VLIWRRSINSCVPIRFASLFDQVLELAGNAARDNKKTRIIPRHVLLAIRNDEELGKLLGG 145 Query: 504 VTIASGGVLPNINPVLLPKKSA--VSENKAPQMKSPSKA 614 VTIA GGVLPNINPVLLPKK+A S + + KSP KA Sbjct: 146 VTIAHGGVLPNINPVLLPKKTAEKASSGGSKEAKSPKKA 184 >gb|ACN26769.1| unknown [Zea mays] gi|413956147|gb|AFW88796.1| histone2A1 [Zea mays] Length = 191 Score = 190 bits (483), Expect = 2e-46 Identities = 105/159 (66%), Positives = 125/159 (78%), Gaps = 5/159 (3%) Frame = +3 Query: 153 KKAIPKSVKAGLQFPVGRIARFLKRGRYAQRMGTGAPIYMAAVLEYLAAEVT-FPI*ICF 329 KK++ +SVKAGLQFPVGRI R+LK+GRYAQR+GTGAP+Y+AAVLEYLAAEV F F Sbjct: 26 KKSVSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEVLQFEPSSLF 85 Query: 330 LIRLLKFLSKCLIKCLCEM--QVLELAGNAARDNKKSRIIPRHVQLAIRNDDELGKLLNG 503 ++ + ++ C+ + QVLELAGNAARDNKK+RIIPRHV LAIRND+ELGKLL G Sbjct: 86 VLIWRRSINSCVPIRFASLFDQVLELAGNAARDNKKTRIIPRHVLLAIRNDEELGKLLGG 145 Query: 504 VTIASGGVLPNINPVLLPKKSA--VSENKAPQMKSPSKA 614 VTIA GGVLPNINPVLLPKK+A S + + KSP KA Sbjct: 146 VTIAHGGVLPNINPVLLPKKTAEKASSVGSKEAKSPKKA 184