BLASTX nr result
ID: Scutellaria23_contig00021728
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00021728 (351 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521259.1| importin beta-2, putative [Ricinus communis]... 60 1e-07 ref|XP_002305534.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 emb|CBI18918.3| unnamed protein product [Vitis vinifera] 59 3e-07 ref|XP_002284755.1| PREDICTED: transportin-1-like [Vitis vinifera] 59 3e-07 emb|CAN77906.1| hypothetical protein VITISV_033175 [Vitis vinifera] 59 3e-07 >ref|XP_002521259.1| importin beta-2, putative [Ricinus communis] gi|223539527|gb|EEF41115.1| importin beta-2, putative [Ricinus communis] Length = 824 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/38 (71%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = +3 Query: 240 STWQPQEEGLREICGLLEQQMSPSSD-DKSVIWQRLQH 350 ++WQPQE+G +EICGLLE Q+SPSS DKS IWQ+LQH Sbjct: 7 ASWQPQEQGFKEICGLLENQISPSSTADKSQIWQQLQH 44 >ref|XP_002305534.1| predicted protein [Populus trichocarpa] gi|222848498|gb|EEE86045.1| predicted protein [Populus trichocarpa] Length = 888 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/39 (69%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = +3 Query: 237 ASTWQPQEEGLREICGLLEQQMSPSSD-DKSVIWQRLQH 350 A+ WQPQEEG +EICGLLE Q+SP+S DKS IW++LQH Sbjct: 6 AAAWQPQEEGFKEICGLLEHQISPTSTADKSQIWKQLQH 44 >emb|CBI18918.3| unnamed protein product [Vitis vinifera] Length = 887 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +3 Query: 246 WQPQEEGLREICGLLEQQMSPSSDDKSVIWQRLQH 350 W+PQEEGL EICGLLEQ +SP+S DKSVIW++LQH Sbjct: 3 WRPQEEGLGEICGLLEQHISPTS-DKSVIWKQLQH 36 >ref|XP_002284755.1| PREDICTED: transportin-1-like [Vitis vinifera] Length = 885 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +3 Query: 246 WQPQEEGLREICGLLEQQMSPSSDDKSVIWQRLQH 350 W+PQEEGL EICGLLEQ +SP+S DKSVIW++LQH Sbjct: 3 WRPQEEGLGEICGLLEQHISPTS-DKSVIWKQLQH 36 >emb|CAN77906.1| hypothetical protein VITISV_033175 [Vitis vinifera] Length = 444 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +3 Query: 246 WQPQEEGLREICGLLEQQMSPSSDDKSVIWQRLQH 350 W+PQEEGL EICGLLEQ +SP+S DKSVIW++LQH Sbjct: 3 WRPQEEGLGEICGLLEQHISPTS-DKSVIWKQLQH 36