BLASTX nr result
ID: Scutellaria23_contig00021666
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00021666 (377 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003627635.1| F-box protein [Medicago truncatula] gi|35552... 61 8e-08 ref|XP_003599496.1| F-box [Medicago truncatula] gi|355488544|gb|... 61 1e-07 ref|XP_003599499.1| F-box protein [Medicago truncatula] gi|35548... 60 1e-07 ref|NP_001241466.1| uncharacterized protein LOC100815072 [Glycin... 60 2e-07 ref|XP_003621771.1| F-box family protein [Medicago truncatula] g... 60 2e-07 >ref|XP_003627635.1| F-box protein [Medicago truncatula] gi|355521657|gb|AET02111.1| F-box protein [Medicago truncatula] Length = 372 Score = 61.2 bits (147), Expect = 8e-08 Identities = 32/63 (50%), Positives = 41/63 (65%) Frame = -2 Query: 193 KMKEEIFECLPPEYFINLPSEVIINILSRLPVRSIIRCKCVCKSWLVLIETQEFASSHLS 14 KMKE ++ LPSE+II IL RLPV+S++ KC+CKSWL LI FA+SH+ Sbjct: 33 KMKETLY----------LPSELIIQILLRLPVKSLLCFKCICKSWLSLISDPHFANSHVD 82 Query: 13 KSA 5 SA Sbjct: 83 VSA 85 >ref|XP_003599496.1| F-box [Medicago truncatula] gi|355488544|gb|AES69747.1| F-box [Medicago truncatula] Length = 370 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/45 (64%), Positives = 32/45 (71%) Frame = -2 Query: 142 LPSEVIINILSRLPVRSIIRCKCVCKSWLVLIETQEFASSHLSKS 8 LP E+II IL RLPV+S+IR KCVCKSWL LI FA SH S Sbjct: 9 LPHELIIQILLRLPVKSLIRFKCVCKSWLTLISDPHFAKSHFDLS 53 >ref|XP_003599499.1| F-box protein [Medicago truncatula] gi|355488547|gb|AES69750.1| F-box protein [Medicago truncatula] Length = 489 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/45 (62%), Positives = 32/45 (71%) Frame = -2 Query: 142 LPSEVIINILSRLPVRSIIRCKCVCKSWLVLIETQEFASSHLSKS 8 LP E+II I+ RLPV+S+IR KCVCKSWL LI FA SH S Sbjct: 123 LPHELIIQIMLRLPVKSLIRFKCVCKSWLALISDHNFAKSHFELS 167 >ref|NP_001241466.1| uncharacterized protein LOC100815072 [Glycine max] gi|255637050|gb|ACU18857.1| unknown [Glycine max] Length = 406 Score = 60.1 bits (144), Expect = 2e-07 Identities = 31/68 (45%), Positives = 45/68 (66%) Frame = -2 Query: 208 PSSDPKMKEEIFECLPPEYFINLPSEVIINILSRLPVRSIIRCKCVCKSWLVLIETQEFA 29 PSS PK ++ + E LP + LP E+++ ILSRLPV+S+++ +CVCKSW+ LI F Sbjct: 31 PSSVPK-QQPMSESLPLPF---LPDELVVEILSRLPVKSLLQFRCVCKSWMSLISDPYFM 86 Query: 28 SSHLSKSA 5 HL S+ Sbjct: 87 KKHLHLSS 94 >ref|XP_003621771.1| F-box family protein [Medicago truncatula] gi|355496786|gb|AES77989.1| F-box family protein [Medicago truncatula] Length = 524 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/54 (53%), Positives = 37/54 (68%) Frame = -2 Query: 166 LPPEYFINLPSEVIINILSRLPVRSIIRCKCVCKSWLVLIETQEFASSHLSKSA 5 LPP LP EV+ ILSRLPVRS+++ KCVCKSW +I +F HL++SA Sbjct: 88 LPPSE--TLPDEVMAEILSRLPVRSLMQIKCVCKSWNTIISDPKFIKMHLNRSA 139