BLASTX nr result
ID: Scutellaria23_contig00021649
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00021649 (333 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531188.1| pentatricopeptide repeat-containing protein,... 55 5e-06 >ref|XP_002531188.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223529229|gb|EEF31203.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 619 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/52 (46%), Positives = 37/52 (71%) Frame = -1 Query: 324 KLLFEMEYKSISPNVLALSPDFINLCKSGRLKEAQKYLELMKERTLVPSTNI 169 KL +EMEY+ +SP +L +P +LC G+L++A+KYL +MK R+L PS + Sbjct: 465 KLYYEMEYRPLSPGLLVFTPLIRSLCHCGKLEQAEKYLRIMKGRSLNPSQQV 516