BLASTX nr result
ID: Scutellaria23_contig00021619
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00021619 (467 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG49895.1| PnFL-1 [Ipomoea nil] 59 4e-07 >gb|AAG49895.1| PnFL-1 [Ipomoea nil] Length = 209 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/58 (48%), Positives = 35/58 (60%) Frame = +1 Query: 46 AKYFALMVGLWAAITSVSRVLLGRHFVLDXXXXXXXXXXXXXXXFRVFNYENLSSWLR 219 A +F ++G WA ITSVSR+LLGRHFVLD FR FNY+ LSS+ + Sbjct: 152 ADHFVYIIGAWATITSVSRILLGRHFVLDVVAGACLGVLEGLFSFRFFNYDKLSSFFK 209