BLASTX nr result
ID: Scutellaria23_contig00021606
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00021606 (408 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527491.1| conserved hypothetical protein [Ricinus comm... 64 2e-08 ref|XP_002527490.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002527491.1| conserved hypothetical protein [Ricinus communis] gi|223533131|gb|EEF34889.1| conserved hypothetical protein [Ricinus communis] Length = 101 Score = 63.5 bits (153), Expect = 2e-08 Identities = 45/97 (46%), Positives = 49/97 (50%) Frame = +1 Query: 109 VQLEASPFDYSGPRRHRPVILPLQRACSYRCSVKPA*RGAHNSKGHKAQAFAWTAWPNSP 288 VQL A P G RH+ VILPL RA RCSVKPA R A S+ AFA Sbjct: 3 VQL-ARPIRPYGLGRHQLVILPLPRAGGCRCSVKPASRCALRSRNQVTPAFAQGHIAQLS 61 Query: 289 LGTGGPE*SPPLAQPFGLAQRPYTLKPPLRLQAHRSE 399 G P +P G QRP TL P LRLQAH +E Sbjct: 62 AWNGRARAQPHQGRPTGPEQRPITLMPLLRLQAHATE 98 >ref|XP_002527490.1| conserved hypothetical protein [Ricinus communis] gi|223533130|gb|EEF34888.1| conserved hypothetical protein [Ricinus communis] Length = 60 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/55 (52%), Positives = 32/55 (58%) Frame = -1 Query: 312 LFWAARSKRXXXXXXXXXXXGFVALRVVGTASGWFHRAAITTRSLQWKDNGPVPP 148 + W ARSK G + R GTA GWFHRAAIT+ S QWKDNGPV P Sbjct: 1 MIWLARSKLRVDPCGLGEGPGSMGPRAEGTALGWFHRAAITSLSWQWKDNGPVLP 55