BLASTX nr result
ID: Scutellaria23_contig00021531
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00021531 (367 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAE17327.1| lipoxygenase [Fragaria x ananassa] 64 1e-08 ref|XP_003556040.1| PREDICTED: linoleate 9S-lipoxygenase 5, chlo... 62 4e-08 ref|XP_003535654.1| PREDICTED: linoleate 9S-lipoxygenase 5, chlo... 61 1e-07 ref|XP_002883361.1| lipoxygenase [Arabidopsis lyrata subsp. lyra... 61 1e-07 ref|XP_003592410.1| Lipoxygenase [Medicago truncatula] gi|355481... 60 2e-07 >emb|CAE17327.1| lipoxygenase [Fragaria x ananassa] Length = 884 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -2 Query: 366 GPIKMPYMLLYPSTSDHTKMGGLTGKGIPNSVSI 265 GPIKMPY LLYPSTSD+++ GGLTGKGIPNS+SI Sbjct: 851 GPIKMPYTLLYPSTSDYSREGGLTGKGIPNSISI 884 >ref|XP_003556040.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Glycine max] Length = 858 Score = 62.4 bits (150), Expect = 4e-08 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = -2 Query: 366 GPIKMPYMLLYPSTSDHTKMGGLTGKGIPNSVSI 265 GP+KMPY LLYP+TSD+++ GGLTGKGIPNS+SI Sbjct: 825 GPVKMPYTLLYPNTSDYSREGGLTGKGIPNSISI 858 >ref|XP_003535654.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Glycine max] Length = 476 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = -2 Query: 366 GPIKMPYMLLYPSTSDHTKMGGLTGKGIPNSVSI 265 GP+KMPY LL+P+TSD+++ GGLTGKGIPNS+SI Sbjct: 443 GPVKMPYTLLFPNTSDYSREGGLTGKGIPNSISI 476 >ref|XP_002883361.1| lipoxygenase [Arabidopsis lyrata subsp. lyrata] gi|297329201|gb|EFH59620.1| lipoxygenase [Arabidopsis lyrata subsp. lyrata] Length = 838 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -2 Query: 366 GPIKMPYMLLYPSTSDHTKMGGLTGKGIPNSVSI 265 GP+ +PY LLYP+TSD+T+ GGLTGKGIPNSVSI Sbjct: 805 GPVNIPYTLLYPNTSDYTREGGLTGKGIPNSVSI 838 >ref|XP_003592410.1| Lipoxygenase [Medicago truncatula] gi|355481458|gb|AES62661.1| Lipoxygenase [Medicago truncatula] Length = 856 Score = 59.7 bits (143), Expect = 2e-07 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = -2 Query: 366 GPIKMPYMLLYPSTSDHTKMGGLTGKGIPNSVSI 265 GP+K+PY LL+P+TSD+++ GGLTGKGIPNS+SI Sbjct: 823 GPVKLPYTLLFPNTSDYSREGGLTGKGIPNSISI 856